KEGG   Saccharomonospora viridis: Svir_05790Help
Entry
Svir_05790        CDS       T00980                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
svi  Saccharomonospora viridis
Pathway
svi00564  Glycerophospholipid metabolism
svi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Svir_05790
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Svir_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox NAD_binding_8 GIDA 3HCDH_N HI0933_like Thi4
Motif
Other DBs
NCBI-ProteinID: ACU95650
UniProt: C7MUT7
LinkDB All DBs
Position
592272..594035
Genome map
AA seq 587 aa AA seqDB search
MSSPPVEVRRDEEAKVTVSLGPVNREESWQRLGDEDFDLVVIGGGVVGVGTALDAATRGL
RVALVEARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTTIAPHLVKPVS
FLYPLTHRVWERPYTATGLLLYDTMGGARSVPGQKHLTRAGALRMVPALKRDALIGGIRY
YDASADDARHTMMVARTAAHYGAVVRTSTQVVGFLREADRVTGVRVRDVEDGRETDVRAS
VVVNCTGVWTDELQHLAGSRGRFRVRASKGVHIVVPRDRIVSETGLILRTEKSVLFVIPW
RSNHWIVGTTDTDWNLDLAHPAATKNDIDYILSHVNKVLATPLTHDDIEGVYAGLRPLLA
GESEETSKLSREHAVARVAPGLVAIAGGKYTTYRVMAADAVDAAAADLPGRPRQSITDKV
PLVGADGYHALVNQADQLAAKHGLHPYRVRHLLDRYGSLVHEVLAQADGKPELLKPIDSA
PDYLKVEAVYAASHEGALHLEDVLARRTRISIEYPHRGVDCAKQVADLMGDVLSWSQETR
AREVELYEARVKAERESQSEPSDESADARRSAAPEARSGLVDLSATA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtccgccggtcgaggtccgccgtgacgaggaggcgaaagtgactgtgtcgttg
ggaccggtgaaccgcgaggagtcatggcagcggttgggcgacgaggacttcgacctcgtc
gtcatcggcggtggtgtcgtaggggtgggcacggctctcgatgcggccacccgggggttg
cgggtcgccctcgtggaggcccgggacctcgcctcggggacgtcgagcaggtcgagcaag
ctgttccacggcgggctgcgctacctggaacaactcgaattcggactggtacgggaggcg
ctgcgggaacgggagttgatgctcaccaccatcgccccccatctggtgaaaccggtgagc
tttctgtacccgttgacgcaccgggtgtgggaacggccgtacacggcgacgggcctgttg
ttgtacgacacgatgggtggtgcccggtcggtgcccgggcagaagcacctgacgcgcgcc
ggggcgttgcgcatggtgccggcgttgaaacgcgacgcgctcatcggcggcatccggtac
tacgacgcgtcggccgacgacgctcggcacacgatgatggtggcgcggacggcggcgcac
tacggtgccgtggtgcgcacgtccacacaggtggtggggttcctgcgggaagcggaccgc
gtgaccggggtacgggtgcgcgacgtggaggacggccgggaaaccgacgtgcgggcgtcc
gtcgtggtcaactgcacgggagtgtggacggacgaattgcagcatctggccgggagccgg
ggccggttccgggtgcgggccagcaagggcgtacacatcgtggtgccgcgggaccgcatc
gtgtccgagaccgggctgatcctgcgtaccgagaagtcggtgttgttcgtcatcccgtgg
cgcagcaaccactggatcgtgggcaccaccgacaccgactggaacctcgacctcgcgcat
ccggccgcgacgaagaacgacatcgactacatcctgtcccacgtcaacaaggtcttggcg
accccgttgacgcatgacgacatcgaaggcgtctacgcgggactgcggccgttgctggcc
ggggagagcgaggagacgtcgaagttgtcgcgggagcacgcggtggcgcgggtcgccccc
ggactggtcgccatcgcgggtggcaagtacacgacgtaccgggtcatggccgccgacgcc
gtggacgccgccgcggccgacctgccggggcggccccgtcagtccatcacggacaaggtt
ccactggtgggcgccgacggctaccacgcgttggtgaaccaggcggatcagctggccgcc
aagcacggtctacacccgtatcgcgtgcggcacctgctcgaccggtacggctcgctcgtg
cacgaggtgctcgcccaggccgacggcaagccggaactgctgaagcccatcgactccgcg
cccgattacctgaaggtcgaagccgtgtacgcggccagccacgagggcgccctgcacctg
gaggacgtcctggcgcggcggacccgcatctcgatcgagtacccgcaccggggtgtggac
tgcgcgaagcaggtcgcggacctgatgggggacgtgctcagctggtcacaggagacccgg
gcccgggaggtcgaactgtacgaggccagggtcaaggccgaacgggagtcgcagtccgag
ccgtccgacgaaagcgccgacgcgcgtcggtccgcggcaccggaggcccgttccggactg
gtggatctgagcgccacggcgtag

DBGET integrated database retrieval system