KEGG   Saccharomonospora viridis: Svir_09160Help
Entry
Svir_09160        CDS       T00980                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
svi  Saccharomonospora viridis
Pathway
svi00473  D-Alanine metabolism
svi00550  Peptidoglycan biosynthesis
svi01100  Metabolic pathways
svi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:svi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Svir_09160
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Svir_09160
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Svir_09160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:svi01011]
    Svir_09160
Enzymes [BR:svi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Svir_09160
Peptidoglycan biosynthesis and degradation proteins [BR:svi01011]
 Precursor biosynthesis
  Amino acid ligase
   Svir_09160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACU95974
UniProt: C7MY26
LinkDB All DBs
Position
940944..942041
Genome map
AA seq 365 aa AA seqDB search
MSSRKTRVAVVFGGRSTEHTISCVSAGSIMANLDPDRFEVVPIGITQEGGWVLGTNDPEQ
LRIKGRELPVVEHGKTLVLAGDPTTGGVLSLTAGEPAEVLSGVDVVFPALHGAFGEDGTI
QGLLELADIPYVGSGVFASAAAMDKEYAKKLLAAEGLEVGRYAVVRRGQDTLPAEERERL
GLPVFVKPARAGSSIGISRVTDWSQLDAAIAHARQTDPKVLVEAETVGREVECGVLEFAD
GRVEASFPSEIRVLSDDADAWYDFETKYLGEDAELDIPAKLDDTITERLRDMAVRAFTAL
ECQGLARVDFFVGPDGTLTVNEVNTMPGFTPTSAYPKMWEVTGIDYPTLLTTLVETALAR
GTGLR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccgtaagacccgagtggccgtcgtcttcggcggtcgaagcaccgagcacacc
atttcctgtgtgtcggcgggcagcatcatggcgaacctcgatcccgaccggttcgaggtc
gtccccatcggtatcacccaggaaggtggctgggtactcggcacgaacgaccccgaacag
ttgcgcatcaaaggcagggaactgcccgtcgtcgaacacgggaagacactggtgctcgcc
ggcgaccccacgacgggtggtgtgctgagcctgacagccggagaacccgccgaggtgttg
tccggggtggatgtggtgttccccgcattgcacggtgctttcggcgaggacggcaccatt
cagggcctgctggagctggccgacatcccctatgtgggttccggcgtgttcgccagtgcg
gccgccatggacaaggaatacgccaagaaactgctcgccgccgagggactggaggtcggc
cgctacgccgtggtccgacgcggccaggacaccctgcccgccgaggaacgggaacgcctc
ggcctgcccgtgttcgtcaaacccgcgcgcgccgggtcgtccatcggcatctcccgggtg
accgattggtcgcaattggacgccgccatcgcgcatgccagacagaccgaccccaaggtg
ctcgtggaggccgagaccgtgggaagggaagtcgagtgcggggtgctcgaattcgccgac
ggcagggtggaggcgtcgttcccctccgagatccgcgtgctgtccgacgacgccgacgcc
tggtacgacttcgagaccaaatacctcggtgaggacgccgaactcgacatccccgccaaa
ctcgacgacacgatcaccgaacgcctccgcgacatggccgtgcgtgctttcaccgcgctc
gagtgccaggggctggccagggtggacttcttcgtcggtcccgacggcaccctcaccgtc
aacgaggtcaacacgatgcccgggttcacccccacctcggcctacccgaagatgtgggag
gtcaccgggatcgactatccgacgttgctcaccacgctcgtggagaccgcgctcgcccgc
ggcaccgggttgcgctga

DBGET integrated database retrieval system