KEGG   Saccharomonospora viridis: Svir_21210Help
Entry
Svir_21210        CDS       T00980                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
svi  Saccharomonospora viridis
Brite
KEGG Orthology (KO) [BR:svi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Svir_21210
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Svir_21210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like Glutaredoxin DAO Thi4 FAD_binding_3 FAD_oxidored FMO-like
Motif
Other DBs
NCBI-ProteinID: ACU97134
UniProt: C7MW34
LinkDB All DBs
Position
complement(2280094..2281665)
Genome map
AA seq 523 aa AA seqDB search
MLDPALTKQLAQHLELLRQPVELVASLDDSAKSAQLMELLTEVAALSEKITVVRRDDDER
RPSFAIVRPGTDISVRFACVPLGHELTSFVLALLQVGGHPPAVSEEVIEQIRRLDGDYEF
VTYLSLSCQNCPEVVQALNLMSVVNPRIKHVAVDGALFKDEVEARGVLAVPSVFLNGEHF
EQGRMTLEQILSKLDSGAAQRAAQEIGNKEPFDVLVVGAGPAGVSSAIYAARKSVRTGVA
AGRIGGQVLDTMAIENFISVPYTEGPKFAAALEQHASDYEIDIMDSQQAVRLEPATQPGD
LHTLVLENDATLKGRTVILATGARWRPIGVPGEQEYRNKGVTYCPHCDGPLFRGKPVAVI
GGGNSGVEAAIDLAGIVSHVTLLELGDTLRADEVLQRKLRSLTNVDIVLNAKTTEVLGDG
TSVTGLTYTDTETGESRRLDVQGVFVQIGLLPNTEWLEGVVELTKHKEIVVDERGATSVP
GVFAAGDCTTEPYKQIVTAMGSGATAALSAFDYLVRTSAPTDD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgacccggcactaaccaagcagctcgcccaacatctcgagcttcttcggcagccg
gtcgaactagtcgcgtcgctggacgacagtgccaagtccgcccagctgatggaactgttg
accgaggttgccgcactctcggagaagatcacggtggtacgccgtgacgacgacgagcgt
cgtccgtcgttcgccatcgtccgaccgggaaccgacatatcggtgcggttcgcctgtgtc
ccgctcgggcatgagctgacctccttcgtgctcgctctgctccaggtcggtggacatccc
cccgcggtgtccgaagaggtcatcgagcagatccggcggctggacggcgactacgagttc
gtcacctacctgtcactgtcctgtcagaactgtcccgaggtcgtccaggcgctcaacctc
atgagcgtggtcaacccgcggatcaagcacgtggccgtcgacggtgccctgttcaaggac
gaggtcgaggcccggggcgtgctcgcggtgccctccgtgttcctcaacggtgaacacttc
gagcagggtcggatgacccttgagcaaattctgagcaaactcgacagtggagccgcacag
cgggccgctcaggagatcggcaacaaggagcccttcgacgtgctcgtcgtcggtgccggg
ccggccggtgtctcctcggcgatctacgccgcccgcaagagtgtccgcaccggggtcgcc
gccggccgtatcggcggtcaggtgctggacaccatggcgatcgagaacttcatctccgtg
ccctacaccgaggggccgaagttcgccgccgcgctcgaacagcacgcctcggattacgag
atcgacatcatggactcgcagcaggccgtgcggctggagccggcgacacagcccggtgac
ctgcacacgttggtgctggaaaacgacgccacgctgaagggacgcaccgtcatcctcgcg
accggcgcccgctggcgtcccatcggggtcccgggggagcaggagtaccgcaacaagggt
gtgacctactgcccccactgcgacggccccttgttccgcggcaagccggtcgcggtgatc
ggtggtggcaattccggagtcgaggccgccatcgacctggcggggatcgtctcgcacgtg
acgttgctggagctcggtgacacgttgcgagccgacgaggtgctgcagcgcaagctgcgc
agcctgaccaatgtggacatcgttctcaacgcgaagaccaccgaggtcctcggcgacggc
acctcggtaacgggccttacctacaccgacaccgagacaggcgagagccgacggctcgac
gtccagggcgtgttcgtgcagatcggcctgctgccgaacaccgagtggctcgagggcgtc
gtcgagttgaccaagcacaaggagatcgtcgtcgacgagcggggcgcgacctccgtgccg
ggagtgttcgccgcgggcgactgcacgaccgagccctacaagcagatcgtgacggcgatg
ggatccggtgcgaccgccgccttgagcgcgttcgactacctggtccgcacctcggctccg
accgacgactga

DBGET integrated database retrieval system