KEGG   Saccharomonospora viridis: Svir_21440Help
Entry
Svir_21440        CDS       T00980                                 

Definition
(GenBank) amino acid transporter
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
svi  Saccharomonospora viridis
Brite
KEGG Orthology (KO) [BR:svi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Svir_21440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Pex24p
Motif
Other DBs
NCBI-ProteinID: ACU97156
UniProt: C7MWQ2
LinkDB All DBs
Position
complement(2306490..2308028)
Genome map
AA seq 512 aa AA seqDB search
MSGSGIWRTKSVEQSIADTDEPDTRLRRNLGAWDLMVFGVAVMIGAGIFTLTAHTAGDIS
GPSVALAFVFAGIACALAGLCYAEFASTVPVAGSAYTYSYATFGEFLAWIIGWDLVLEFS
VAAAAVAKGWSVYLQEVLTMAFGEGIATTVQLGSVSVDWGSLLLIIILATLLTLGTKLSS
RFSLVITALKVAIILFVIIMGLGYISPDNYTPFIPPAAEGGESGAGLEQSLFSALVGESG
SVYGAFGLLAGASLVFFAFLGFDVVATTAEETRNPQRNVPRGILGSLAIVTVLYVATSLV
VVGMAPYTELATDAEPEGRKTLATAFSLHGVDWAAGVISIGALAGLTTVVMVLLLGQQRV
FFAMSRDGLLPRKLAKTGTRGTPVRVNILVGIMVAVAATFFDAGKLEEMVNVGTLFAFIL
VSAGVLVLRKKRPDLSRGFRVPLVPLVPILAIAACVWLMLNLTVLTWVRFLVWMVLGVVV
YFAYSKRHSLLGQREQDKASESDKPLANSGQE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgggcagcggtatttggcgaacgaagtcggtcgagcaatcgatcgcagatactgat
gagccagacacccggttacgcagaaacctcggtgcgtgggacctgatggtctttggcgtc
gcggtgatgatcggcgcgggtattttcacgctcaccgcacataccgccggagatatttca
gggccgtcggtggcgctcgcgttcgtgttcgccggtatcgcgtgtgcgctcgcggggttg
tgctacgccgagttcgcctccacggttcccgtcgccggtagtgcctatacgtactcctac
gccacgttcggtgagttcctcgcgtggatcatcggctgggacctcgtcctggagttctcc
gtggccgcggccgcggtggccaaaggctggtccgtgtacctgcaagaagtgctgacgatg
gcgttcggcgaaggcatcgccaccaccgtgcagctcggctcggtcagcgtcgactggggc
tcgctactgctgatcatcatcctggccacgctgctgaccctcggcaccaagctgtcgtcg
cggttcagcctcgtgatcacggcgctcaaggtcgcgatcatcctcttcgtgatcatcatg
ggcctcggctacatcagcccggacaactacactccgttcatcccgcccgccgccgaaggc
ggtgaatcgggcgccggtctcgaacagtccctgttctcggcgctcgtcggcgagtccggc
agcgtctacggcgcgttcggcctcctcgccggggcttcgctggtgttcttcgccttcctc
ggcttcgacgtcgtggccaccaccgccgaggagacccgcaacccgcaacgcaacgtgccg
cgcggcatcctcggctcgctggcgatcgtcaccgtgctctacgtggcgacctccctcgtg
gtcgtcggcatggctccctacacggagctggccaccgacgccgagccggagggtcgtaag
acgctggccacggcgttctccctccacggcgtcgactgggcggcgggcgtcatctccatc
ggcgcactcgccggcctcaccacggtcgtcatggtgctgctgctcggccaacagcgcgtg
ttcttcgcgatgtcgcgagacggcctgttgccgcgcaagctcgcgaagaccggtacgcgc
ggcaccccggtgcgggtgaacatcctcgtcggcatcatggtcgccgtggccgccaccttc
ttcgacgccggcaagctcgaggagatggtcaacgtcggaacgctgttcgcgttcatcctg
gtgtcggccggtgtgctcgtgctacgcaagaagcgtccggatttgtcccgcggcttccgc
gtgccactggtcccgcttgtgccgatcctggcgatcgccgcttgtgtctggctgatgctg
aacctgaccgtgttgacctgggtgcgcttcctcgtgtggatggtgctcggcgtggtcgtg
tacttcgcctacagcaagcggcattcgctgctcggtcagcgggagcaagacaaggcgagc
gagagcgacaaaccgctggccaactccggccaggagtga

DBGET integrated database retrieval system