KEGG   Saccharomonospora viridis: Svir_23940Help
Entry
Svir_23940        CDS       T00980                                 

Definition
(GenBank) penicillin-binding protein, beta-lactamase class C
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
svi  Saccharomonospora viridis
Brite
KEGG Orthology (KO) [BR:svi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Svir_23940
Enzymes [BR:svi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Svir_23940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACU97391
UniProt: C7MYH2
LinkDB All DBs
Position
2581938..2583074
Genome map
AA seq 378 aa AA seqDB search
MRPLRIPVLGAVLSLAATAFIGPAVAVASETETAAEILREGAQLGVDNGYPGVIGLVRDG
TDTEYVQAGLGDRFTRVPADPQARFRIGSNTKAFIATVLLQLEAEDRLSLDDTLDTWLPD
VFARSGHDGSTITVRQLLNHTSGLPEYLNDPRVLASYAANLNPYRKWEPRKLVEIALRQG
ATGAPGERHSYSNTNYLLAGMVIEAVTGNPPHVEVRQRIISPLGLHDTSFPTDPRPQGEW
LRGYFRIGGFLRDVTVSNVDITGSAGAMVSTLDDLATFERALLSGELLPEPQLAALKDTV
PLTEDGSAGAGLGVFLTPTPCGPVWQHSGALLGYTTLWLTSDDGDKQVVVAANEYHLVGG
GPGEQHIARAAVEAYCAL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagacccctacgtattcccgtactcggcgcggtcctgtcacttgcggccaccgccttc
atcggacccgccgtcgcagtggcgtccgaaacggaaaccgccgccgagatcctgcgggaa
ggcgcccagctcggggtcgacaacggatatcccggggtgatcggcctggtccgcgacggt
acggacacagaatatgtccaggccggactcggcgaccgtttcacgagggtccccgccgac
ccgcaagcccgcttccgcatcggtagtaacaccaaggcgttcatcgccaccgtgctgctg
cagttggaagccgaagaccggctctcactcgacgacacactcgacacctggttgcccgat
gtgttcgcacgaagcggccatgacggttcgacgatcaccgtccggcaattgctcaaccac
acctccgggctgccggagtacctcaacgaccctcgagtgctggcgtcctacgccgcgaac
ctcaacccctacaggaagtgggagccccggaagctggtggagatcgccctccggcaaggg
gccaccggcgcccccggggaacgacacagctactccaacaccaactacctgttggcgggc
atggtgatcgaagccgtcaccggcaatccgccccacgtcgaggtccggcagcgcatcatc
tccccgctcggcctgcacgacaccagcttccccaccgaccctcggccgcagggcgagtgg
ctgcgcggatacttccggatcggtggattcctacgggacgtgaccgtgtccaatgtggat
atcactggctccgccggggccatggtttccactttggacgacctggcgacgttcgagcga
gcactgctgtcgggcgagttgctgcccgaaccacagctggccgctctgaaggacaccgta
ccgctcaccgaggacgggtccgcgggcgcggggctgggcgttttcctgacaccgacgccc
tgcggaccggtatggcaacactccggcgcgctcctcggctacaccacgttgtggttgacc
agcgacgacggtgacaagcaagtcgtcgtggccgccaacgagtatcacctggtgggcggc
ggcccaggcgagcagcacatcgcccgggccgcggtggaggcctactgtgccctctga

DBGET integrated database retrieval system