KEGG   Saccharomonospora viridis: Svir_30190Help
Entry
Svir_30190        CDS       T00980                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
svi  Saccharomonospora viridis
Pathway
svi00250  Alanine, aspartate and glutamate metabolism
svi00410  beta-Alanine metabolism
svi00640  Propanoate metabolism
svi00650  Butanoate metabolism
svi01100  Metabolic pathways
svi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:svi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Svir_30190
   00650 Butanoate metabolism
    Svir_30190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Svir_30190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Svir_30190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:svi01007]
    Svir_30190
Enzymes [BR:svi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Svir_30190
Amino acid related enzymes [BR:svi01007]
 Aminotransferase (transaminase)
  Class III
   Svir_30190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACU97994
UniProt: C7MX77
LinkDB All DBs
Position
3268945..3270204
Genome map
AA seq 419 aa AA seqDB search
MAQLSPILKQATPVVVDHGEGAYLYDTDGRRHLDFTAGIGVTSTGHCHPRVVRAAQEQIG
KLIHGQYTTVMHRPLLELSERLGEVLPNGLDSLFFANSGSEAVEAALRLTRQATGRPNVV
VFQGGFHGRTVAAASMTTSGTRFSAGFSPLMGGVHVAPFPNAFHYGWDERTTTEFALREL
DYLFATQTSPQETAAFFIEPMLGEGGYVPANTEFFAGLRRRADEHGILLVIDEIQTGFGR
TGKFWGHQHFDVRPDVLLIAKGLASGFPLSGIAASKELMSKAWPGSQGGTYGGNAVSCAA
AIATLDVIAEENLVENAAARGKQLLDGARAIGEKTPGIGDVRGLGLLVGSEFVTSDGKPD
AATAQAAQQAAAQKGLLLLTCGPFMNVVRMIPPLVVTAEQVDEALEIWADVVASVTTGS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctttccccgatcctcaagcaggccacaccggtcgtcgtcgatcacggcgaa
ggtgcatacctctacgacaccgacggacgtcgccacctcgacttcaccgcgggcatcggc
gtcaccagcaccggccattgccacccccgcgtggtgcgcgccgcgcaggaacagatcggc
aagctgatccacggccagtacaccaccgtcatgcaccgtcctctgctcgaattgagcgag
cgtctcggcgaggtcctgccgaacggactcgactcgctcttcttcgccaattcgggcagc
gaggccgtcgaggccgccctccggctgacccgtcaggccacgggcaggcccaacgtcgtc
gtgttccagggcggcttccacggccgcaccgtggcggcggcgtcgatgaccacctccggc
actcggttcagcgccgggttctcaccgttgatgggcggcgtgcacgtggccccgttcccc
aacgccttccactacggctgggacgagaggaccaccacggagttcgcgctgcgggaactg
gattacctcttcgccacccagacctcaccgcaggagacggccgcgttcttcatcgaaccg
atgctcggcgaaggcggttacgtacccgccaataccgagttcttcgccggcttgcgacgc
cgcgccgacgaacacggcatcctgctggtgatcgacgagatccagaccggcttcggccgg
accgggaagttctggggacaccagcacttcgacgtccgacccgacgtcctcctcatcgcg
aagggactggccagcggtttcccgttgtcgggcatcgccgcgtcgaaggagctgatgagc
aaggcctggcccggttcgcagggcggcacctacgggggcaacgccgtgtcgtgtgcggcg
gccatcgccaccctcgacgtcatcgccgaggagaacctcgtcgagaacgcggccgcgcgg
ggcaagcagttgctcgacggcgcgcgggcgatcggcgagaagaccccgggcatcggcgac
gtgcgcggcctcggcctgctggtgggttcggagttcgtcacatccgacggcaagcccgac
gccgcgacggcgcaggctgcgcagcaggccgccgcgcagaagggactgctcctgctcacc
tgcggaccgttcatgaacgtcgtacggatgatcccgcccctggtcgtgaccgccgaacag
gtggacgaggcgctggagatctgggccgacgtcgtcgcatcggtgaccaccggctcctga

DBGET integrated database retrieval system