KEGG   Saccharomonospora viridis: Svir_33380
Entry
Svir_33380        CDS       T00980                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
svi  Saccharomonospora viridis
Pathway
svi00331  Clavulanic acid biosynthesis
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
Module
svi_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:svi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    Svir_33380
Enzymes [BR:svi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     Svir_33380
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 DUF1933
Other DBs
NCBI-ProteinID: ACU98302
UniProt: C7N0A0
LinkDB
Position
3631258..3632796
AA seq 512 aa
MGSSPIIGFSIHLGTVAPTDTGSIPPWVSTGHAIPVLVEPKTSGEPYWSGWALAGDSRAT
AVASHDGVTVLLAGELYHRAELGSVVGETADGLSDAELLLACWLRYGPSGLRLCNGRFAA
VVAENDSVVVATDHAGTIPLYLRTRPDGVDVATEAKVLAEGAGDSFPAPGTEPAPGLTGV
RRVQAGTAVTLVPGSTVAEAARTWRPPHHRLIVSPDEAMNRVADVLDKAVRTRLGGPHDP
VTAVLSGGIDSSSVVALASGGGRPVRTISLGTDIGDEFAAARVVAEHLGTRHHEFRCSSE
ELVRQLPWAVAAAEIVDAEVLEYLLPLVVLYRMVPNEGTRIVTGYGADIPLGGMHRTTER
LHSLDEVIAFDMGTFDGLNELSPVLGSMAGHWTTHPFWDRDVLDLLTALEPGLKRRDGRD
KWVLREAMRELLPTATVTRPKLGIHEGSGTSSAWSQLLRRVGVAESDLASVKTAMAAVFH
RRTVREQEPPGEVSFDDVLDEVMSEQNLAVTR
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggctcatccccgatcatcgggttctcgatacacctcggcaccgtcgccccgaccgac
accgggtcgatcccgccgtgggtgagcaccggccacgcgatacccgtgctcgtcgaaccc
aagacctccggggaaccgtactggagcggctgggccctggcgggtgactcccgggcgacg
gccgtggccagccacgacggggtgaccgtgctgttggcgggcgagctctaccaccgggcg
gaactggggtccgtggtgggcgaaacggccgatggcctctccgacgccgagttgctgctg
gcctgctggctgcgttacgggccgtcggggctgcggctgtgcaatggtcggttcgccgcc
gtcgtcgccgagaacgacagcgtggtggtggccaccgatcacgccgggaccatcccgctc
tacctgcggacccgtcccgacggtgtcgacgtcgccaccgaggccaaggtccttgccgaa
ggggcaggggattcgttccccgccccgggcacggaacccgcccccggtctcaccggcgta
cgtcgggtacaggcgggtacggccgtgaccctggtgccgggttccaccgtggccgaagcc
gcacgcacctggcggccaccgcatcatcgcctgatcgtgtccccggacgaagcgatgaac
cgggtggcggacgtgctcgacaaggcggtgcgtacccggttgggcgggccacacgatccg
gtcaccgccgtgctctcgggtgggatcgactccagttcggtggtggcgctggcaagcggc
gggggacggccggtgcggacgatctccttgggcaccgacatcggagacgaattcgccgcc
gctcgtgtcgtcgccgaacacctgggcactcggcaccacgagttccgttgcagcagcgaa
gaactcgtccggcaactgccgtgggcggtcgctgccgccgagatcgtcgacgcggaggtg
ctggagtacctgctgcctctggtcgtgctctatcgcatggtcccgaacgagggcacccgc
atcgtgaccggctacggcgccgacatccccctcggcggcatgcaccggaccaccgaacgg
ctgcattcgttggacgaggtgatcgccttcgacatgggcacgttcgacggcctgaacgaa
ctgtccccggtgctcggcagcatggcggggcattggaccacgcacccgttctgggatcgc
gacgtcctggatctgttgaccgcgctcgaaccgggactcaaacgccgtgacgggcgagac
aaatgggtgctgcgggaagcgatgcgggagttactgcccaccgccaccgtgacccgtccc
aagctcggcatccacgagggctcggggacgagtagcgcgtggtcacaactgttgcgccgg
gtcggcgtcgcggagtccgacctggcttcggtcaaaacggcgatggcggccgtgttccac
cgccggacggtccgggaacaggaaccacccggcgaggtgtccttcgacgacgtgctggat
gaggttatgtccgaacagaatctggcggtgacgcgatga

DBGET integrated database retrieval system