KEGG   Saccharomonospora viridis: Svir_34920Help
Entry
Svir_34920        CDS       T00980                                 

Definition
(GenBank) DNA ligase D/DNA polymerase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
svi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:svi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Svir_34920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:svi03400]
    Svir_34920
Enzymes [BR:svi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Svir_34920
DNA repair and recombination proteins [BR:svi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Svir_34920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACU98454
UniProt: C7MQ31
LinkDB All DBs
Position
3792932..3794365
Genome map
AA seq 477 aa AA seqDB search
MAPRLEQYRNKRRKGHTPEPIPSVTLASTEGHGDTFVVHEHHARNLHWDVRLERDGRLIS
FAVPKGLPTEPGTVRLAVRTEDHPLEYSTFSGEIPKGEYGGGHMSIWDRGTYETLKWGES
KVSIVLHGERVHGKYVFFRTRESDWSVVRSDPPDDPEWTPIPSLLKPMLAVTGSLPDPEE
DSDWAYEFKWDGVRALARVEGGRVTLFSRRGDDITGIYPELRALGEDLGSTQAWLDGEIV
AFRDGRPHFATLQGRINAGAQKARRLSQRSPVTYLVFDLLHLDGHSCMGLPYWQRRNLLE
QLDITGEHWRTPPSFPGAGRAVTEAAAEQRLEGVVAKRLDSPYRPGERSVDWRKITELRT
LEVVIGGWRQGRGRRSDTFGSLLLGIPNDGRLQYIGQVGTGFDEDALHALTSRLHRLERR
TSPFSEALPKDRTSGAHWVSPRLVGEVAFKSWTDDGRLRAPTWRGLRPDRDPEELAR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcgactcgagcagtaccggaacaagcggaggaaaggacacacccccgaaccg
atacccagcgtaactctcgcgtcgacggagggccacggcgacacgttcgtcgtgcacgag
catcatgcccgcaatctgcactgggacgtgcgcctcgagcgcgacggcaggctgatctcg
ttcgcggtaccgaagggacttcccactgaaccgggcacagtgcgactcgccgtgcgcacc
gaggaccatccgctggagtactcgacgttctccggagagatcccgaaaggcgagtacggc
ggcggacacatgtcgatctgggaccgaggtacctatgagactctcaagtggggcgagagc
aaggtctcgatcgtcctgcacggtgaacgggtgcacggcaagtacgtgttcttccgcacc
cgggaaagtgattggagcgtcgtacgttccgatccaccagacgatccagagtggacccca
attccctccctcctcaaacccatgctcgccgtgacgggctccctgcccgaccccgaggag
gactccgactgggcatacgagttcaaatgggacggtgtacgcgccctcgcccgggtcgaa
ggggggagagtcacgctgttctcccggcgaggcgacgacatcaccgggatctatccggaa
ttgcgtgcgctcggcgaggatttgggaagcacccaggcttggctggacggtgagatcgtg
gcgttccgagacggcagaccacacttcgccaccctgcaaggccgcatcaacgcgggagcg
cagaaggcccggaggttgtcccagcgctccccggtcacgtatctcgtgttcgacctgctg
cacctcgacggccattcctgcatgggactgccctactggcagcggaggaacctgctggag
cagctcgacatcacgggtgaacattggcgaacccctcccagcttccccggggccggtcga
gcggtcacggaggccgctgccgaacaacgactggaaggggtcgtcgccaagcgcctcgac
tccccctaccgccccggggaacgcagcgtcgactggcgcaagatcaccgaactgcggacg
ttggaggtggtcatcggcggctggcggcaaggccggggaagacgctccgacaccttcggc
tcgctcctgctgggcatccctaacgacggtcggcttcagtacatcggccaggtcggaacc
ggattcgacgaggacgccctgcacgccctcacctccagactgcaccggctggaacgccgg
acctcgccgttctccgaagccttaccgaaagaccggacgagcggagctcactgggtcagt
ccgcgactcgtgggcgaggtcgcgttcaagtcgtggaccgacgacggccgactgcgcgca
ccgacgtggcgggggctgcgccccgaccgcgatccggaggagttggcgcgatga

DBGET integrated database retrieval system