KEGG   Saccharomonospora viridis: Svir_34930Help
Entry
Svir_34930        CDS       T00980                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
svi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:svi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Svir_34930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:svi03400]
    Svir_34930
Enzymes [BR:svi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Svir_34930
DNA repair and recombination proteins [BR:svi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Svir_34930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACU98455
UniProt: C7MQ32
LinkDB All DBs
Position
3794362..3795273
Genome map
AA seq 303 aa AA seqDB search
MTTMTQPVDIEGRRLELSNLDKILYPEHGFTKGELIDYYARVAPVLLPHVRDRPLTLKRY
PDGVEGKSFFEKNVSTHAPDWVRTVPIETPESSHSRKSADFALVQDLSTLVWAANLASIE
LHIPQWTVGPRGERRNPDLLVFDLDPGAPATIVDCCEVALWLRDELTDDGLTAYPKTSGS
KGLQLYAPVQTRSDDRTNDYAKRVAEKLERRHPRRVVSRMAKKLRVGKVLIDWSQNNPKK
TTVAPYSLRARSAPTVSTPVTWSEVEACENPAELGFVADEVLDRVDEHGDLFESLLTRAR
PSL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatgacacaaccagtcgacatcgagggacgccgactcgaattatccaatttg
gacaaaattctctacccggaacacggattcaccaagggcgagctcatcgactactacgca
cgggtggctccggtgctgttaccccacgtgcgggaccgtccgctcaccctgaaacgctat
cccgacggggtcgagggtaagtcgttcttcgagaagaacgtctccacccacgcacccgac
tgggtacgcaccgtgcccatcgagacaccggagagctcgcacagccgaaaaagcgccgac
ttcgcgctcgttcaggacctgtcgaccttggtgtgggccgcgaacctcgcgagcatcgaa
ttgcatatcccgcaatggaccgtcgggccacgaggagaaagacgcaatccggacttgctc
gtgttcgacctcgatcccggagcccccgccacgatcgtcgattgttgcgaggtggcgctg
tggctacgcgacgaactcaccgacgacggactgaccgcgtatccgaaaaccagcggctcg
aaaggattgcaactctacgctcccgtacagacacgttccgacgaccgaacgaacgactac
gccaagcgagtggccgagaagctggagcgtcgacatccgcgccgggtcgtatcccgcatg
gcgaagaagctgcgcgtcggcaaagtgctcatagactggagccagaacaaccccaagaaa
accaccgtcgcgccctactcattgcgcgcgagatcggcgcccaccgtgtccacaccggta
acctggtcggaggtcgaagcctgcgagaacccggcggagctcgggttcgtggccgacgag
gtgctggaccgtgtcgacgagcacggcgacctgttcgaatcccttttgacgcgagccagg
ccgtccctttga

DBGET integrated database retrieval system