KEGG   Streptomyces violaceusniger: Strvi_0339Help
Entry
Strvi_0339        CDS       T01602                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
svl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:svl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Strvi_0339
Enzymes [BR:svl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Strvi_0339
DNA repair and recombination proteins [BR:svl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Strvi_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEM80127
UniProt: G2PB75
LinkDB All DBs
Position
complement(108002..108940)
Genome map
AA seq 312 aa AA seqDB search
MSEKRTDARNVRAGSRTVRISRPEKVLFPDDGITKWDLVAYYRSVSRRIIPQLRGRPLMM
ERHPDGIGGKPLMQKNAPDYFPDWVRRAVLPKEGGEVTHVVCDDTATLLYLADQACVTPH
RWLSRADRPDHPDRLVFDLDPPPAEESAFEEVRWTARRCCGLLGELGLPGLLMTTGSHGL
HVIVPLDRRADFDTVRSFARDAAELLAARHPDRLTTEPRKAKRRGRLYLDIRRNAYAQTA
VAPYAVRARPGAPVATPIDAAELDDPALSADRWTLRTVGERLADDPWARTDTRGRSLRAP
RERLRRLAEGEG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagcggaccgatgcgcgaaacgtcagggccgggagccgcaccgtacggatc
agccgcccggaaaaggtgctcttccccgacgacgggatcacgaagtgggatctcgtcgcg
tactaccgctcggtctcccggcgcatcattccgcagttgcgcggccgccctttgatgatg
gaacgccatccggacggaatcggcggcaagccgctgatgcagaagaacgcccccgactac
tttccggactgggtgcgccgcgccgtactgcccaaagagggcggcgaggtcactcatgtg
gtctgcgacgacaccgcgaccctcctctacctcgccgaccaggcgtgcgtcaccccgcac
cgctggctctcccgcgccgaccggcccgaccaccccgaccggctggtcttcgacctcgat
ccgcccccggcggaggagtccgcattcgaggaggtgcgctggacggcccggcgctgctgc
gggctgctcggcgagctcgggctgccggggctgctgatgaccaccggctcccacggactg
catgtcatcgtcccgctggaccgccgcgccgacttcgacaccgtacggtccttcgcgcgc
gatgccgccgagctgctggccgcccgccaccccgaccggctcaccaccgagccgcgcaag
gcgaagcggcgcggtcggctctatctggacatccggcgcaacgcctacgcccagaccgcc
gtcgccccgtacgcggtgcgcgcccgccccggagcccccgtcgccacgcccatcgacgcg
gctgagctggacgacccggcgctgagcgccgaccgctggacgctgcggaccgtcggcgag
cggctcgcggacgacccctgggcccgtacggacaccaggggccgttccctgcgcgccccc
cgcgagcggctgcggcggctcgcggagggcgaaggctag

DBGET integrated database retrieval system