KEGG   Streptomyces violaceusniger: Strvi_1991Help
Entry
Strvi_1991        CDS       T01602                                 

Definition
(GenBank) thiamine pyrophosphate central domain-containing protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00290  Valine, leucine and isoleucine biosynthesis
svl00650  Butanoate metabolism
svl00660  C5-Branched dibasic acid metabolism
svl00770  Pantothenate and CoA biosynthesis
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01130  Biosynthesis of antibiotics
svl01210  2-Oxocarboxylic acid metabolism
svl01230  Biosynthesis of amino acids
Module
svl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
svl_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Strvi_1991
   00660 C5-Branched dibasic acid metabolism
    Strvi_1991
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Strvi_1991
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Strvi_1991
Enzymes [BR:svl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Strvi_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEM81725
UniProt: G2PCC5
LinkDB All DBs
Position
complement(1902863..1904539)
Genome map
AA seq 558 aa AA seqDB search
MPTAQRARHGGDLVVESLTALGASTVFGLPGQHALGAFDALRRSGLTYVGLRVENNAGFA
ADAFARVTGTVAPLLVSTGPGALMTLAALQESAAASAPVLAIGSQVPTAGLGGGRKGYLH
ELVDQKASFRDVVKSVHTVRTASQIPSAVAAAWASALEAPAGPVWLEIPQDVLLAPVSVP
PVTSLRAEPRPLPPRPELTAEAARLLDAAERPVILAGGGVVRAGARQELRALAEALDAPV
ATTFGGKGAFPWDHPLSLQSWLEDAHTTEFLEDADVLLVVGSGLGELSSNYHTFRPRGRL
VQIEADLGKLESNHPALGIHADAREALAALTEAVTPRPPGTAAKAAAGLLTRVRERIDGQ
GLELEQRVLGAVRDALPDDSASFWDMTILSYWAWSAFDCRAGALHSAQGAGGLGYGFPAA
LGAAAADPARPVLAVSGDGGAMYSIAELATAHQYRLPVTWLIVDDGGYGILREYMTDTFG
EATATELSRPDFVTLAESFGVPAVRTTPERLRADLAGALAAPGPSVVVLPALLRMFAPTH
LDRLADGGPDDSPGPDQG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgcacagcgcgcgcgtcacggcggcgatctcgtcgtggagtccctcaccgcg
ctcggggcgagcaccgtgttcgggcttcccggacagcacgctctcggggcgttcgacgcg
ctgcggcggtccgggctcacctatgtggggctgcgggtggagaacaacgccgggttcgcc
gccgacgccttcgcgcgtgtcaccggcacggtcgcgccgctgctggtgtccaccgggccg
ggggcgctcatgacgctcgccgcgctgcaggagtcggcggcggcttccgcgcccgtcctg
gccatcggcagccaggtgccgaccgcggggctcggcggcgggcgcaagggctatctccat
gaactcgtcgaccagaaggcgtcgttccgcgacgtcgtcaagtccgtccacacggtccgt
accgcctcccagatcccctccgcggtcgccgccgcctgggcgtccgcgctggaggccccc
gccgggccggtgtggctggagatcccgcaggacgtgctgctcgcgccggtctccgtgccg
ccggtgacctccctgcgcgccgagccccggccgctgccgccccggcccgagttgacggct
gaggccgcgaggctgctggacgccgccgagcgtccggtgatcctggccgggggcggagtg
gtgcgcgccggggcgcggcaggagctgcgggcgctggccgaggcgctggacgcgcccgtg
gcgacgaccttcggcggcaagggcgcgttcccgtgggatcatccgctctcgctccagtcc
tggctggaggacgcgcacaccaccgagttcctggaggacgccgatgtcctgctggtcgtc
ggctccggactgggcgaactctcctccaactaccacacgttccgcccgcgcggccggctg
gtccagatcgaggccgacctcggcaagctggagtccaaccacccggcgctcggcatccac
gccgacgcccgcgaggcgctggccgccctcaccgaggccgtcacgccccgaccgccgggc
acggcggccaaggccgcggccgggctgctcacccgggtgcgggagcggatcgacgggcag
ggtctggagttggagcagcgggtgctgggcgcggtgcgggacgcgctgcccgatgactcc
gccagcttctgggacatgacgatcctctcctactgggcctggtcggccttcgattgccgt
gcgggcgccctgcactcggcgcagggcgcgggcggtctcggctacggcttcccggccgcc
ctcggggccgccgccgctgatcccgcacggccggtgctggccgtgtcgggcgacggcggg
gcgatgtactcgatcgccgaactcgccacggcccaccagtaccggctccccgtcacctgg
ctgatcgtggacgacggcggctacggcatcctgcgcgagtacatgacggacacgttcggc
gaggcgaccgccaccgagctgtcccgtccggacttcgtcacgctggccgagtccttcggc
gtcccggcggtccgtaccacacccgagcggctgcgcgcggacctcgccggcgccctcgcg
gcccccgggccgtcggtcgtggtgctgcccgcgctgctgcggatgttcgcgcccacccac
ctcgaccggctcgccgacggcggccccgatgacagccccggacccgatcagggctga

DBGET integrated database retrieval system