KEGG   Streptomyces violaceusniger: Strvi_2526Help
Entry
Strvi_2526        CDS       T01602                                 

Definition
(GenBank) Catalase related subgroup domain-containing protein
  KO
K03781  catalase [EC:1.11.1.6]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00380  Tryptophan metabolism
svl00630  Glyoxylate and dicarboxylate metabolism
svl01110  Biosynthesis of secondary metabolites
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Strvi_2526
  Amino acid metabolism
   00380 Tryptophan metabolism
    Strvi_2526
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Strvi_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AEM82246
UniProt: G2PCR8
LinkDB All DBs
Position
complement(2546601..2548700)
Genome map
AA seq 699 aa AA seqDB search
MTEDRKERQRDQYRAPDPAEGPLTTDQGVAVDHTDDSLTVGERGPTLMEDFHFREKITHF
DHERIPERVVHARGAGAYGYFEPYESCAEFTRAAFLQDPSVRTPVFVRFSTVQGPRGSAD
TVRDVRGFATKFYTSEGNYDLVGNNMPVFFIQDGIKFPDFVHALKPEPHNDIPTGASAHD
TLWDFVSLQPETMHMMMWLMSDRAIPRSFRMMQGFGVHTFRFVDAQGRGTFVKFHWKPKL
GVHSLVWDEAQEAAGRDPDFNRRDLWQAIEAGQYPEYELGVQLIPEEDEFNFDFDLLDAT
KIIPEEQVPVRPIGHMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQARNFSYLD
TQLIRLGGPNFSQLPVNQPVTPARTNHRDGYHQTMIHKGTNYSPNSLGGGCPALAGADGY
AFSHYAERVEGHKIRKRSESFKDFYSQAALFWNSMSDWEKRHIVDAFRFELGKVEAVHVR
ERTVEQLARVDYGLASQVAQGIGVAMPEPGANTHKPQASPALSLENLQGDGSIRTRQIAV
LVTDGVDTAQLTQAQEALTAQGAVVEALAPHDGKVVGADGNGYAVDRALPTVASVLYDAV
LLPGGPPGTPDLASDSAAMRFVRDAYRHGKPIGALGSGVGILSSLDPEGLHIASGHGHVC
ADRGVVTDTTTGTASEEFTRAFTEAIAAHRHWDRPRVRC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggaccgcaaggagcggcagcgcgaccagtaccgcgcccccgaccccgccgaa
ggaccgctgaccaccgaccagggcgtggcggtcgaccacaccgatgactccctcaccgtg
ggcgaacgcggcccgacgctgatggaggacttccacttccgcgagaagatcacccacttc
gaccatgagcgcatcccggagcgggtggtgcacgcgcggggcgcgggcgcgtacggctac
ttcgagccgtacgagtcctgcgcggagttcacccgcgccgcgttcctccaggacccgtcc
gtgcgcaccccggtcttcgtacggttctccaccgtgcaggggccccggggctcggcggac
acggtgcgggacgtgcggggcttcgcgacgaagttctacacctcggagggcaactacgac
ctggtcggcaacaacatgccggtcttcttcatccaggacgggatcaagttccccgacttc
gtgcacgcgctcaagccggagccgcacaacgacatcccgaccggcgcctccgcccatgac
actctgtgggacttcgtctccctgcagcccgagacgatgcacatgatgatgtggctgatg
tcggaccgggccattccgcgcagcttccggatgatgcagggcttcggggtgcacaccttc
cgcttcgtggacgcgcaggggcgcggcaccttcgtgaagttccactggaagccgaagctg
ggcgtccactcgctggtgtgggacgaggcgcaggaggccgcgggccgcgacccggacttc
aaccggcgcgatctgtggcaggcgatcgaggcgggtcagtaccccgagtacgagctgggg
gtgcagttgatcccggaggaggacgagttcaacttcgacttcgatctgctcgacgccacg
aagatcattccggaggagcaggtaccggtgcggccgatcggccacatggtcctgaaccgc
aacccggacaacttcttcgcggagaccgagcaggtggccttccacacggcgaacgtcgtc
cccggtatcgacttcaccaacgacccgctgctgcaggcccggaacttctcgtatctggac
acccagctcatccggctgggcggccccaacttctcccagctcccggtcaaccagccggtc
accccggcccggaccaaccaccgggacggctaccaccagaccatgatccacaagggcacc
aactactcccccaactcactcggcggcggctgcccggccctcgcgggcgcggacggctat
gccttctcccattacgcggagcgggtcgagggccacaagatccgcaagcggagcgagtcc
ttcaaggacttctacagccaggccgcgctgttctggaacagcatgagcgactgggagaag
cgccatatcgtggacgccttccgcttcgagctgggcaaggtcgaggcggtgcatgtgcgc
gagcgcacggtcgagcagttggcccgggtcgactacggcctggcctcgcaggtggcccag
ggcatcggcgtggcgatgccggagccgggcgccaacacccacaagccgcaagcctcgccc
gcgctgagcctggagaacctccagggcgacggctcgatccgcacccgccagatcgcggta
ctggtcacggacggggtggacaccgcccagctcacccaggcccaggaggcgctcaccgcc
cagggcgccgtcgtcgaggccctcgccccgcacgacggcaaggtggtcggcgccgacggc
aacggctacgcggtcgaccgcgccctccccacggtcgcctccgtcctctacgacgccgtc
ctcctccccggaggcccccccggcacccccgacctggcctccgacagcgcggccatgcgc
ttcgtccgcgacgcctaccgccacggcaaacccatcggcgcactgggctcgggcgtcggc
atcctctcctccctcgacccggagggcctccacatcgcctccggccacggccacgtctgc
gccgaccgcggcgtggtcacggacacgacgacgggcacggcgagcgaagaattcaccagg
gccttcaccgaagcgatagcggcccaccggcactgggaccgcccgcgggtccgctgctga

DBGET integrated database retrieval system