KEGG   Streptomyces violaceusniger: Strvi_2896Help
Entry
Strvi_2896        CDS       T01602                                 

Definition
(GenBank) Protein of unknown function DUF2510
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2510 SLD5_C
Motif
Other DBs
NCBI-ProteinID: AEM82595
UniProt: G2PCW9
LinkDB All DBs
Position
2984920..2985888
Genome map
AA seq 322 aa AA seqDB search
MNTPPGWYPDPGYAGNGPAMERWWDGSAWTEYTRDASGAADPAFGPPPLPPYLPGRQGGH
GRGRGPRIAAVSVAAGVVVAAIVGGIVLLGDGGDGGGGNAQTGPAAPSDSAPPDGGDPAP
DLPSPDSPSGGPTDAPSAPPSYDPDTAPDPGNGISLPVLTGWQAGRSSSGGAGVTTSRYP
CPGDPSTECVRGGAFSRTAEGYKATSAKGIAKEDIAQNAEESYGTDEDNNRKAYGGITSH
KELKESAVEVAGGKGYLVRWKVVTKKGDDGVVQSLAFPSPTVPDTMVVVRFGFDESDKAP
PLSDMDKIVKGIEALTGDGRSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgccccccggctggtaccccgatcccggctacgcaggtaacggccccgccatg
gaacggtggtgggacggttccgcctggaccgagtacacccgcgatgcctcgggcgccgcg
gacccggccttcggcccgccgcccctgccgccctacctgccagggcggcagggcggccac
ggccggggccgcggcccgaggatcgcggcggtctcggtcgccgcgggcgtcgtggtcgcc
gcgatcgtcggtggcatcgtgctgctgggcgacggcggcgacggcggtggtggcaacgcc
cagaccgggcccgccgcccccagcgactccgcaccgccggacggcggcgacccggccccc
gacctccccagcccggacagcccctcgggcgggcccaccgacgcccccagcgcaccgccc
agctacgacccggacaccgccccggaccccggcaacggcatcagtctgccggtgctcacc
ggctggcaggcggggcgcagcagctccggcggcgcgggcgtcaccacctcccgctacccc
tgcccgggcgacccgtccaccgaatgtgtgcgcggcggcgccttctcccggaccgccgag
ggctacaaggccacctccgccaagggcatagccaaggaggacatcgcgcagaacgccgag
gagtcctacggcaccgacgaggacaacaaccgtaaggcgtacggcgggatcacctcccac
aaggagctgaaggagtcggcggtcgaggtcgcgggcgggaagggctatctggtccgctgg
aaggtggtgacgaagaagggcgacgacggcgtcgtccagtcgctggccttcccgtcgccc
accgtgccggacacgatggtcgtggtgcgcttcgggttcgacgagagcgacaaggcgccg
ccgctcagcgatatggacaagatcgtcaagggcatcgaggcactgacgggcgacggccgg
tccatctag

DBGET integrated database retrieval system