KEGG   Streptomyces violaceusniger: Strvi_4064Help
Entry
Strvi_4064        CDS       T01602                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00250  Alanine, aspartate and glutamate metabolism
svl00410  beta-Alanine metabolism
svl00640  Propanoate metabolism
svl00650  Butanoate metabolism
svl01100  Metabolic pathways
svl01120  Microbial metabolism in diverse environments
Module
svl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Strvi_4064
   00650 Butanoate metabolism
    Strvi_4064
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Strvi_4064
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Strvi_4064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:svl01007]
    Strvi_4064
Enzymes [BR:svl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Strvi_4064
Amino acid related enzymes [BR:svl01007]
 Aminotransferase (transaminase)
  Class III
   Strvi_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEM83722
UniProt: G2P4I4
LinkDB All DBs
Position
4424399..4425658
Genome map
AA seq 419 aa AA seqDB search
MTNLSPQLRQATPVVAVRGEGAYIDGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVG
TLIHGQYTTVMHPPLRRLVEKLGEVLPTGLDSLFFSNSGSEAVESALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAYRYGWDEETATRFALREL
DYVLQTISPPDDTAAIIVEPVLGEGGYVPATEGFLQGLRERADRHGFLLILDEVQTGVGR
TGRFWGHDHFGIRPDILVTAKGLASGFPLSGIAASEELMSKAWPGSQGGTYGANAVACAA
AAATLDVVREENLVANAEAMGARLRSGLEDVAAKTPAIGDVRGLGLMLASEFVTEDGEPD
PATAARVQRAAVDEGLLLLLCGAWNHVVRMIPALVVDEAAIDEGLRAWSAAVSAGTADS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatctgtcgccgcagctccgtcaagccactccggtggtcgccgtccgaggagag
ggcgcctacatcgacggcgaggacgggcggcgatacctcgacttcaccgcgggcatcggc
gtcaccagcaccggacactgccatccgcgggtcgtcgccgccgcgcaggagcaggtgggc
acgctcatccacggccagtacacgaccgtcatgcacccaccgctgcggcggctggtcgag
aagctgggcgaggtgctccccaccggcctcgacagtctgttcttctccaactccggcagc
gaggccgtcgagtcggccctgcgcctcgcccgccaggccaccggccggcccaacgtcctg
gtctgccacggcggattccacggccgcacggtggccgccgcctccatgaccacctccgga
acccgcttccgctccggcttctcgcccctgatgagcggcgtcgtggtgaccccgttcccc
acggcctaccggtacggctgggacgaggagaccgcgacccggttcgccctgcgggagctg
gactacgtcctgcagaccatctccccgcccgacgacaccgccgcgatcatcgtcgaaccg
gtgctcggcgagggcggctacgtacccgccaccgagggcttcctgcagggcctgcgggag
cgggccgaccgccatggcttcctgctgatcctggacgaggtgcagaccggggtgggccgc
accggacggttctggggccatgaccacttcggcatccgccccgacatcctggtcaccgcc
aaggggctggccagcggcttcccactgtccggcatcgccgcctccgaggagctgatgagc
aaggcatggcccggctcccagggcggcacctacggcgccaacgccgtggcctgcgcggcc
gccgccgccaccctcgacgtggtccgcgaggagaacctggtggccaacgccgaggcgatg
ggggcgcggctgcgcagcggtctggaggacgtggccgccaagaccccggccatcggcgat
gtgcgcggcctcggcctcatgctggccagcgaattcgtcaccgaggacggggagccggac
ccggcgaccgcggcccgggtacagcgcgccgccgtggacgagggactgttgctgctcctg
tgcggggcctggaaccatgtggtccggatgatccccgccctcgtcgtcgacgaagcggcg
atcgacgagggtctgcgcgcctggtccgccgccgtcagcgccggaacagcggactcctga

DBGET integrated database retrieval system