KEGG   Streptomyces violaceusniger: Strvi_4270Help
Entry
Strvi_4270        CDS       T01602                                 

Definition
(GenBank) ABC-type transporter, periplasmic subunit family 3
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
svl  Streptomyces violaceusniger
Brite
KEGG Orthology (KO) [BR:svl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:svl02000]
    Strvi_4270
Transporters [BR:svl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    Strvi_4270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AEM83921
UniProt: G2NU32
LinkDB All DBs
Position
complement(4756684..4757487)
Genome map
AA seq 267 aa AA seqDB search
MSARSALPVIAVAAVSALLAGCTSTKSSGSGGGDISLVNSGKLTTCTHLPYPPFQSKQGK
KIVGFDVDMVDLVASALDVKQEIVDTPFEGIQSGEDLNTNQCDVAAAGMTITDVREKNLD
FSAPYFEATQALLTTKGKPYKTLAGLKGKKLAVQQGTTGESYAQKHAKGVKLVQFEDLAL
LLTAVKTGQTDAGINDNGVLYDYVKDNADTTVTAEFDTGEQYGIAVRTGNDALRKKIDAV
LKDARADGSYDRIYKKWFGTAPKTDAR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgctcgctccgcgttgcccgtcatagccgtcgccgccgtatccgccctcctggcc
gggtgcaccagcaccaagtcgtcggggtccggcggcggcgacatcagcctggtgaattcc
gggaagctcacgacctgcacacatctgccctatccgcccttccagtccaagcagggcaag
aagatcgtcggcttcgatgtggacatggtcgacctcgtggcctcggcactcgatgtgaag
caggagatcgtggacacgcccttcgagggcatccagtccggggaggacctcaacaccaac
cagtgcgacgtggccgccgccgggatgaccatcaccgacgtacgcgagaagaacctggac
ttctccgccccgtacttcgaggccactcaggcgctgctcaccaccaagggcaagccctac
aagaccctcgccggcctcaagggcaagaagctcgcggtccagcaggggaccaccggtgag
agttacgcccagaagcacgccaagggcgtcaagctggtccagttcgaggatctcgcgctg
ctgctgaccgccgtcaagaccgggcagaccgacgccggcatcaacgacaacggtgtgctc
tacgactacgtcaaggacaacgccgacaccacggtgacggccgagttcgacaccggcgag
cagtacggcatcgccgtgcggaccggcaatgacgcgctgcgcaagaagatcgacgcggtg
ctgaaggacgcccgggcggacggctcctacgaccgtatctacaagaagtggttcggcacc
gcgcccaagacggacgcccgctga

DBGET integrated database retrieval system