KEGG   Streptomyces violaceusniger: Strvi_4558Help
Entry
Strvi_4558        CDS       T01602                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEM84160
UniProt: G2P4Y3
LinkDB All DBs
Position
5068201..5069682
Genome map
AA seq 493 aa AA seqDB search
MKERLMYRREFYIGGEWVKPAGTEVLKVVSPSSEEVVGEVPVATVADMDRAVAAARAAFD
EGPWPRMTPAERANVLARAAELLREGNPEIAGVLVEEMGVAGSQAPLQTGTIAPVFAYYA
DLVRTYEFDRVERSGDHVGLVVSDPVGVVGAIVPWNAPVTLAAWKVAPALAAGCTVVLKP
PPESPLSNYLLAEALHEAGVPAGVFNVVPGDREVGEHLVTHPGTDKIAFTGSTAAGKRIM
SLCGNQVKRVSLELGGKSAALVLDDADVETITAHMVRASMHNSGQVCAAVTRILVPRKRY
AEALEAGAAMAAKIPVGDPHDPSTVVGPLVAERQRARVEGYIGLAAEEGFKVVVGGGRPS
HLPRGWYVEPTILGDVDNSMRVAQEEIFGPVVSLIPHDGDEDAVRIANDSRYGLFSTVWS
GDDARGMAIARRLRTGGTVVNGGIPPQPYVPFGGFKESGLGRELGVEGLHQYLEPHTIGV
PAAFAATMKGEAR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaacgtctgatgtaccgccgggagttctacatcggaggcgagtgggtcaagccc
gcgggcaccgaggtgctcaaggtcgtctcaccgtcgtccgaagaggtcgtcggtgaggtt
ccggtcgcgaccgtcgcggacatggaccgcgccgtggcggctgcccgtgcagccttcgac
gagggtccgtggccccggatgaccccggccgagcgagccaatgtgctggcccgcgcagcc
gagttgctcagggagggcaaccccgagatcgccggagtgctcgtcgaggagatgggcgtg
gccggcagtcaggcccccctgcagaccgggacgatcgccccggtgttcgcctactacgcc
gatctggtccgcacctatgaattcgaccgcgtggagcgctccggtgaccacgtgggtctg
gtggtctcggacccggtaggcgtggtcggggcgatcgtgccctggaacgccccggtgacg
ttggccgcgtggaaggtggccccggcactggcggccggctgcaccgtggtgctgaagccg
ccgcccgagtcaccgctcagcaactacctcctcgccgaggcgctgcacgaggcgggcgtg
cccgccggggtgttcaacgtcgtgcccggcgaccgtgaggtgggcgaacacctcgtgacc
catcccggcaccgacaagatcgccttcaccggctcgaccgcggccggcaagcgcatcatg
agcctgtgcggcaaccaggtcaagcgggtctccctcgaactcggcgggaagtccgcggca
ctcgtcctcgacgacgccgacgtggagaccatcaccgcccacatggtccgcgccagcatg
cacaactccggtcaggtgtgcgccgccgtcacccggatcctggtgccccgcaagcggtat
gcggaggcgctcgaagcgggggcggccatggcggcgaagatccccgtgggagatccgcac
gatccgtcgaccgtggtgggccccctcgtcgccgagcggcagcgcgcccgggtggagggc
tacatcggcctggcggccgaggagggcttcaaggtcgtcgtcggtggcggccgcccgagc
catctccccagggggtggtacgtcgagccgacgatcctcggcgacgtggacaactcgatg
cgggtagcgcaggaggagatcttcgggccggtcgtgtccctgattccgcacgacggcgac
gaggacgcggtccgtatcgccaacgactccaggtacgggctgttcagcacggtgtggtcg
ggcgacgacgcccggggtatggcgatcgcccggcggctgcgtaccggaggaaccgtggtc
aacggcggcatccccccgcagccgtacgtgcccttcggcgggttcaaggagtcgggcctc
ggccgtgaactcggcgtcgagggactgcaccagtacctcgaaccccacaccatcggcgtg
cccgccgcgttcgccgcgaccatgaagggagaggcgcgatga

DBGET integrated database retrieval system