KEGG   Streptomyces violaceusniger: Strvi_8532Help
Entry
Strvi_8532        CDS       T01602                                 

Definition
(GenBank) carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00061  Fatty acid biosynthesis
svl00280  Valine, leucine and isoleucine degradation
svl00620  Pyruvate metabolism
svl00630  Glyoxylate and dicarboxylate metabolism
svl00640  Propanoate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
svl01212  Fatty acid metabolism
Module
svl_M00082  Fatty acid biosynthesis, initiation
svl_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Strvi_8532
   00630 Glyoxylate and dicarboxylate metabolism
    Strvi_8532
   00640 Propanoate metabolism
    Strvi_8532
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Strvi_8532
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Strvi_8532
Enzymes [BR:svl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Strvi_8532
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Strvi_8532
    6.4.1.3  propionyl-CoA carboxylase
     Strvi_8532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_D23 LAL_C2 ATP-grasp_3 ATPgrasp_Ter ATPgrasp_ST RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEM87841
UniProt: G2P102
LinkDB All DBs
Position
9839381..9841129
Genome map
AA seq 582 aa AA seqDB search
MRKVLIANRGEIAVRVARACRDAGIASVAVYADPDRDACHVRAADEAYALGGDTPAASYL
DQAKVLAAAAESGADAVHPGYGFLSENAEFAQAVLDAGLTWIGPPPHAIRDLGDKVAARH
IAQRAGAPLVAGTPDPVSGADEVVAFAEQHGLPIAIKAAFGGGGRGLKVARAMEDVPELY
DSAVREAVAAFGRGECFVERYLDKPRHVETQCLADTHGNVVVVSTRDCSLQRRHQKLVEE
APAPFLTQEQNDQLYAASKAILKEAGYVGAGTVEFLVGMDGTISFLEVNTRLQVEHPVTE
EVTGIDLVREMFRIADGEAIGYDDPQVRGHSFEFRINGEDPGRNFLPAPGTVTSFVPPAG
PGVRLDAGVESGSVIGPAWDSLLAKLIVTGATRTQALQRAARALAEFQVEGMATAIPFHQ
AVVVDPAFTSEPFTIHTRWIETEFNNTITPFAPVSPDEDEEPTGRETVVVEVGGKRLEVS
LPASLGVATAPAGGSKKPKRKAVKKSGSAASGDALASPMQGTIVKVAVNEGDTVAEGDLI
VVLEAMKMEQPLNAHRAGTVKGLAAEVGASITSGAVICEIKD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaggtgctcatcgccaaccgtggcgagatcgctgtccgtgttgcccgtgcctgc
cgggatgccgggatcgcgagcgtagccgtctacgccgatccggaccgggacgcatgtcat
gtgcgcgcggccgatgaagcctatgcgctgggcggtgacaccccggcggccagttatctc
gaccaggccaaggtccttgccgcggccgccgaatccggcgccgacgccgtccaccccggc
tacggattcctctccgagaacgccgaattcgcccaggccgtcctcgacgcgggcctgacc
tggatcggccccccgccgcacgccatccgcgacctgggcgacaaggtcgccgcccgccac
atcgcccagcgcgccggcgccccgctggtcgccggcacccccgacccggtctccggcgcg
gacgaggtcgtggccttcgccgaacagcacggcctgcccatcgccatcaaggccgccttc
ggcggcggcggccgcggcctgaaggtcgcccgcgccatggaagacgtccccgaactctac
gactccgccgtccgcgaggccgtcgcggcgttcgggcgcggcgaatgcttcgtcgagcgc
tacctcgacaagccccgccatgtggagacccagtgcctggccgacacccacggcaacgtc
gtggtcgtctccacccgtgactgctccctccagcgccgccaccagaagctggtcgaagag
gccccggcacccttcctgacccaggagcagaacgaccagctctacgccgcctccaaagcc
atcctcaaggaggccggctatgtgggggcggggacggtggagttcctggtcggtatggac
ggcacgatctccttcctggaggtcaacacccgtctccaggtggagcacccggtcaccgag
gaggtcaccggcatcgacctggtccgcgagatgttccgcatcgccgacggcgaggccatc
ggctacgacgacccgcaggtgcgcggccactccttcgagttccgcatcaacggcgaggac
ccgggccgcaacttcctgcccgccccgggcacggtgacctccttcgtcccgcccgccggc
cccggtgtccggctggacgcgggtgtggagtcggggagtgtcatcggtccggcgtgggac
tcgctgctggccaagctgatcgtcaccggcgccacccgcacccaggccctccagcgcgcc
gcccgcgccctggccgagttccaggtcgagggcatggccaccgcgatcccgttccaccag
gcggtggtggtggacccggcgttcaccagcgagccgttcacgatccacacccgctggatc
gagaccgagttcaacaacaccatcacccccttcgcccccgtcagccccgacgaggacgag
gagcccaccggccgcgagacggtcgtggtcgaggtcggcggcaagcggctcgaggtctcg
ctgcccgcctccctgggcgtggccaccgccccggcgggcggctcgaagaagccgaagcgc
aaggcggtcaagaagtccggctccgccgcctccggcgacgccctggcctcccccatgcag
ggcaccatcgtgaaggtcgccgtcaacgagggtgacaccgtggccgagggcgacctcatc
gtcgtcctggaggccatgaagatggaacagcccctcaacgcccaccgcgcgggcaccgtc
aagggcctggccgccgaggtcggcgcgtccatcacctcgggcgcggtcatctgcgagatc
aaggactga

DBGET integrated database retrieval system