KEGG   Streptomyces violaceusniger: Strvi_8617Help
Entry
Strvi_8617        CDS       T01602                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00020  Citrate cycle (TCA cycle)
svl00190  Oxidative phosphorylation
svl00650  Butanoate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Module
svl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
svl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_8617
   00650 Butanoate metabolism
    Strvi_8617
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Strvi_8617
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Strvi_8617
    1.3.5.4  fumarate reductase (quinol)
     Strvi_8617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 DAO HI0933_like Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: AEM87925
UniProt: G2P1H6
LinkDB All DBs
Position
9928938..9930692
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIESTKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTIKGGDYLVDQDAAEILAKEAIDSVLDLEKMGLPFNRTPNGTIDQRRFGGHS
RNHGEAPVRRSCYASDRTGHMILQTLYQNCVKEGVEFFNEFYVLDLLMTEVDGVKRTAGV
VAYELATGELHVFQAKAVVFASGGCGKFFKVTSNAHTLTGDGQAVAYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYTMGGIP
TNVQGEVLADNDTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYSAR
ADFVELPEDPAAFVQNQVESLRDATGTERVTEVRKALQETMDKNVMVFRTEQTLKEAVEE
LGHLRARFKNVSVQDKGKRFNTDLLEAIELGNLLDLAEVMAISALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGADGSESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccataagtacgacaccgtcatcgtcggcgccggcggggccggaatgcgcgcg
gccatcgagtcgaccaagcgcagccgcaccgcggtgctcaccaagctctacccgacccgc
tcccacaccggcgcggcgcagggcggcatggccgccgccctcgccaatgtcgaggaggac
aactgggagtggcacaccttcgacacgatcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgactccgtcctcgacctggagaagatgggc
ctgccgttcaaccgcaccccgaacggcaccatcgaccagcgccgcttcggcggccacagc
cgtaaccacggcgaggccccggtccgccggtcctgctacgcctcggaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggacctcctgatgaccgaggtcgacggggtcaagcgcaccgccggtgtg
gtggcctacgagctggccaccggtgagctgcacgtcttccaggcgaaggccgtcgtcttc
gcctccggcggctgcggcaagttcttcaaggtgacctccaacgcgcacaccctcaccggt
gacggccaggcggtcgcctatcggcgcgggctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcggatgggcatcctgctgacggagggcgcccgcggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgccggtcatg
aaggacctggcatcgcgagacgtggtgtcgcggtccatctacacggagatccgcgagggc
cgcggctgcggtccggagggcgaccacgtctatctggacctgacccacctgccgccggag
caactggacgccaagctgcccgacatcaccgagttcgcgcggacctacctgggcatcgag
ccgtacacggacccgatcccgatccagccgaccgcgcactacacgatgggcggcatcccg
accaacgtccagggcgaggtgctggcggacaacgacaccgtcgtcccgggcctgtacgcg
gccggcgaggtcgcctgcgtctcggtgcacggcgccaaccgcctgggcaccaactcgctg
ctcgacatcaacgtcttcggccgccgggcgggcatcgccgccgcggagtactccgccagg
gccgacttcgtcgagcttccggaggacccggccgcgttcgtccagaaccaggtggagagc
ctgcgggacgcgaccggcaccgagcgggtcaccgaggtgcgcaaggcgctgcaggagacc
atggacaagaacgtcatggtcttccgcaccgagcagacgctcaaggaggccgtcgaggag
ctcggccacctgcgggcgcggttcaagaacgtcagcgtccaggacaagggcaagcggttc
aacaccgatctgctggaggccatcgagctgggcaatctgctcgacctggccgaggtcatg
gcgatctccgcgctggcccgcaaggagtcgcgcggcggccactaccgcgaggactacccg
aaccgcgacgacgtcaacttcatgcggcacaccatggcgtaccgagaggtgggcgcggac
ggttccgagtccatccgcctcgactacaagccggtcgtgcagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system