KEGG   Streptomyces violaceusniger: Strvi_8618Help
Entry
Strvi_8618        CDS       T01602                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00020  Citrate cycle (TCA cycle)
svl00190  Oxidative phosphorylation
svl00650  Butanoate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Module
svl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
svl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_8618
   00650 Butanoate metabolism
    Strvi_8618
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Strvi_8618
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Strvi_8618
    1.3.5.4  fumarate reductase (quinol)
     Strvi_8618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_4 Fer4_6 Fer4_2 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AEM87926
UniProt: G2P1H7
LinkDB All DBs
Position
9930692..9931465
Genome map
AA seq 257 aa AA seqDB search
MSTPTLEKSDQAPEAADATASHLITVTFRIRRFNPEVSDQAVWEDFQIDMDPKERVLDGL
HKVKWELDGTLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDINPEKPITVEAIKGLTV
LKDLIVDMEPFFQAYRDVMPFLITTGNEPTRERLQSAEDRERFDDTTKCILCAACTSSCP
VFWNDGQYFGPAAIVNAHRFIFDSRDEGGEQRLEILNDKDGVWRCRTTFNCTEACPRGIE
VTKAIQEVKRALITRRF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccaccctcgagaagtccgaccaggcccccgaggcggccgacgccaccgcc
tcgcacctgatcaccgtcaccttccggatccggcgcttcaacccggaggtctcggaccag
gcggtctgggaggacttccagatcgacatggacccgaaggagcgcgtcctcgacggtctc
cacaaggtcaagtgggaactggacggcaccctgaccttccgccgctcctgcgcccacggc
atctgcggatccgacgcgatgcggatcaacggccgcaaccggctggcctgcaagacgctg
atcaaggacatcaacccggaaaagcccatcacggtcgaggcgatcaaggggctcacggtc
ctcaaggacctgatcgtggacatggagccgttcttccaggcgtaccgcgatgtgatgccc
ttcctgatcacgacgggcaacgagccgacgcgtgagcgactgcagtccgccgaggaccgt
gagcggttcgacgacaccaccaagtgcatcctgtgcgccgcgtgcacctcctcgtgcccg
gtgttctggaacgacggccagtacttcggcccggcggcgatcgtcaacgcgcaccgcttc
atcttcgactcccgcgacgagggcggtgagcagcggctggagatcctgaacgacaaggac
ggcgtctggcgctgccgcaccaccttcaactgcaccgaggcgtgcccgcggggcatcgag
gtcaccaaggccattcaggaggtcaagcgcgctttgatcacgcgccgcttctga

DBGET integrated database retrieval system