KEGG   Streptomyces violaceusniger: Strvi_8651Help
Entry
Strvi_8651        CDS       T01602                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00020  Citrate cycle (TCA cycle)
svl00640  Propanoate metabolism
svl00660  C5-Branched dibasic acid metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Module
svl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_8651
   00640 Propanoate metabolism
    Strvi_8651
   00660 C5-Branched dibasic acid metabolism
    Strvi_8651
Enzymes [BR:svl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Strvi_8651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEM87955
UniProt: G2P1K6
LinkDB All DBs
Position
complement(9968962..9970155)
Genome map
AA seq 397 aa AA seqDB search
MEKGRTRVDLFEYQARDLFAKHGVPVLAGEVIDTPEAAREVAERLGGRAVVKAQVKVGGR
GKAGGVKLASDPADAVEKAGQILGMDIKGHTVHKVMLAQTADIKEEYYVSFLLDRTNRTF
LAMASVEGGVEIEVVAEQNPEALAKIPVDAIEGVTQEKAAEIVAAAKFPAEIADQVVEVL
QKLWVVFIKEDALLVEVNPLVKADDGKIIALDGKVSLDENAAFRQPEHEALEDKAAANPL
EAAAKAKGLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGNVKPANFLDIGGGASAE
VMANGLEIILGDPDVKSVFVNVFGGITACDAVANGIVQALELLKSKGEDVSKPLVVRLDG
NNAELGRKILTDANHPLVQQVDTMDGAAERAAELAAK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagggacggacgcgcgtggacctgttcgaataccaggcgagggacctcttcgcc
aagcacggtgtgccggtgctggccggtgaagtcatcgacacgcctgaggcggcgcgcgag
gtggccgagcgcttgggcggccgcgcggtcgtcaaggcgcaggtgaaggtgggcggccgc
ggcaaggccggtggcgtcaagctggcctccgacccggccgacgccgtggagaaggccggc
cagatcctgggtatggacatcaagggccacacggtccacaaggtgatgctggcccagacc
gcggacatcaaggaggagtactacgtctccttcctgctggaccgcaccaatcggaccttc
ctcgccatggcctccgtcgagggcggcgtggagatcgaggtcgtcgcggagcagaacccc
gaggcgctcgccaagatcccggtggacgccatcgagggcgtgacccaggagaaggccgcc
gagatcgtcgccgccgcgaagttcccggccgagatcgcggaccaggtcgtcgaggtcctg
cagaagctgtgggtcgtcttcatcaaggaagacgccctgctcgtcgaggtcaacccgctg
gtcaaggccgacgacggcaagatcatcgcgctggacggcaaggtctccctggacgagaac
gccgccttccgccagccggagcacgaggcgctcgaggacaaggccgcggccaaccccctc
gaggcggccgcgaaggccaagggcctcaactacgtcaagctcgacggcgaggtcggcatc
atcggcaacggcgcgggcctggtcatgtcgaccctcgacgtcgtcgcctacgccggtgag
aaccacggcaatgtgaagcccgccaacttcctcgacatcggtggtggcgcctccgccgag
gtaatggccaacggtctcgagatcatcctcggcgacccggacgtcaagtcggtcttcgtc
aacgtcttcggtggcatcaccgcctgtgacgctgtcgccaacggcatcgtccaggccctg
gagctgctgaagtccaagggcgaggacgtctccaagccgctggtcgtgcgcctcgacggc
aacaacgcggagctgggtcgcaagatcctcaccgacgccaaccacccgctcgttcagcag
gtggacaccatggacggcgcggccgagcgtgccgccgagctggctgcgaagtaa

DBGET integrated database retrieval system