KEGG   Streptomyces violaceusniger: Strvi_8918Help
Entry
Strvi_8918        CDS       T01602                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00053  Ascorbate and aldarate metabolism
svl00071  Fatty acid degradation
svl00280  Valine, leucine and isoleucine degradation
svl00310  Lysine degradation
svl00330  Arginine and proline metabolism
svl00340  Histidine metabolism
svl00380  Tryptophan metabolism
svl00410  beta-Alanine metabolism
svl00561  Glycerolipid metabolism
svl00620  Pyruvate metabolism
svl00625  Chloroalkane and chloroalkene degradation
svl00903  Limonene and pinene degradation
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_8918
   00053 Ascorbate and aldarate metabolism
    Strvi_8918
   00620 Pyruvate metabolism
    Strvi_8918
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Strvi_8918
   00561 Glycerolipid metabolism
    Strvi_8918
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Strvi_8918
   00310 Lysine degradation
    Strvi_8918
   00330 Arginine and proline metabolism
    Strvi_8918
   00340 Histidine metabolism
    Strvi_8918
   00380 Tryptophan metabolism
    Strvi_8918
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Strvi_8918
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Strvi_8918
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Strvi_8918
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Strvi_8918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEM88219
UniProt: G2P1P1
LinkDB All DBs
Position
complement(10315773..10317230)
Genome map
AA seq 485 aa AA seqDB search
MSYFSELALQFIDGEWRGGSGSWDIVDFNPYNGEKLASITVATVEEVDLAYRAAERAQPE
WGGTNPYARRAVFERALRIIEDREKEFTEAIIAECGGTHVKAGFELHLAKEFLREAVHLA
LRPEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPHQ
NTPVCGGGLVAKIFEEAGLPAGLLNVVVTDIAEIGDALIEHPVPKVISFTGSDKVGRHVA
TVAASHFKRTVLELGGNSALVVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDRAVE
REFTEKFVAKVETLKVGDPGDPTTHIGPLINEGQAEAIASLVEQTIAEGATALVRGRTEG
TLMGPTVLSGVPEGAAILGQEIFGPVVTLIPFDGDEEAVRIANDTDYGLSGAVHTGDIER
GVRFARQVHTGMIHVNDSTVHDEPIVPFGGEKHSGLGRLNGESMIEDFTTTKWISIQHGR
SQFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttctccgagttggcccttcagttcatcgacggcgagtggcgcggcggaagc
ggttcctgggacatcgtcgacttcaacccctacaacggggagaagctggcctccatcacc
gtggcgaccgtcgaggaggtggacctggcctaccgggcggccgagcgggcacagccggag
tggggcggcaccaacccctatgcccggcgggcggtcttcgagcgggcgctgcggatcatc
gaggaccgcgagaaggagttcaccgaggcgatcatcgcggagtgcggcggcacccatgtg
aaggcgggcttcgagctgcatctcgccaaggagttcctgcgggaggcggtccatttggcg
ctgcggcccgagggccgcatcctgccgtcgccggtcgacggcaaggagaaccgcctctac
cggctgccggtgggcgtggtcggcgtcatcagccccttcaacttccccttcctgctgtcg
ctgaagtcggtcgcccccgcgctggcgctcggcaacgccgtcgtcctcaagccgcaccag
aacaccccggtctgcggcggtggcctggtcgccaagatcttcgaggaggccgggctgccc
gccgggctgctcaatgtcgtggtcaccgacatagcggagataggcgacgccctgatcgag
caccccgtaccgaaggtgatctccttcaccggctccgacaaggtcggccggcatgtcgcc
accgtggccgcctcccacttcaagcgcacggtcctggagctgggcggcaacagcgcgctg
gtcgtgctggacgacgccgacctggactacgcggtcgacgcggccgtcttcagccgcttc
gtccaccaggggcaggtctgcatggcggccaaccgggtgctggtggaccgggcggtggag
cgggagttcaccgagaagttcgtggccaaggtggagacgctgaaggtgggcgacccgggc
gaccccaccacccacatcggcccgctgatcaacgagggccaggccgaggcgatcgcctcg
ctcgtcgagcagacgatcgccgagggcgccaccgcgctggtgcgggggcgcaccgagggc
accctgatggggccgaccgtgctcagcggggtcccggagggcgcggcgatcctcgggcag
gagatcttcggcccggtggtgaccctgattccgttcgacggcgacgaggaggccgtccgg
atcgccaacgacacggactacgggctcagcggggccgtgcacaccggggacatcgagcgc
ggggtgcggttcgcccggcaggtccacaccggcatgatccatgtgaatgacagcacggtc
cacgacgagccgatcgtgccgttcggcggggagaagcactccggtctcggacggctcaac
ggcgaatcgatgatcgaggacttcaccaccaccaagtggatctccatccagcacggccgg
agccagttcccgttctga

DBGET integrated database retrieval system