KEGG   Shewanella violacea: SVI_1884
Entry
SVI_1884          CDS       T01206                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
svo  Shewanella violacea
Brite
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SVI_1884 (sodB)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: BAJ01855
UniProt: D4ZJK6
LinkDB
Position
complement(2177131..2177712)
AA seq 193 aa
MAFELPALPYAKDALEPHISQETIEFHYGKHHNTYVVKLNGLVDGTELAEKSLEEIIKTS
TGGIFNNAAQIWNHTFYWNCLSPNGGGVATGAVAKAIDDAFGSFEEFKAKFTDSAVNNFG
SAWTWLVKNADGSVAIVNTSNAATPLTDSSVTPIMTVDVWEHAYYIDYRNVRPNYLAHYW
ELVNWDFVNKNFA
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctttcgaattacctgcattaccgtatgcaaaagacgcactagaacctcatatctca
caagagactattgaatttcattatggcaagcatcacaacacttatgttgttaagcttaat
ggtctagttgacggcactgaacttgctgaaaaaagccttgaagagatcatcaagacgtca
actggcggtatcttcaacaatgctgcacagatctggaaccacactttttactggaactgt
ttatcaccaaatggtggtggcgtagcaactggtgcagtagctaaagcgattgatgacgct
tttggctctttcgaagaattcaaagctaaattcactgattcagctgtcaataacttcggt
agcgcatggacttggctagttaagaatgctgacggtagcgtcgctattgttaatactagc
aatgcagctacacctttgaccgatagcagtgtgacacctatcatgacagtcgatgtatgg
gaacatgcctactacatagattaccgtaacgtacgtcctaattacttagcccattactgg
gaattggttaactgggatttcgttaacaaaaatttcgcgtaa

DBGET integrated database retrieval system