KEGG   Shewanella violacea: SVI_2736Help
Entry
SVI_2736          CDS       T01206                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
svo  Shewanella violacea
Pathway
svo00020  Citrate cycle (TCA cycle)
svo00190  Oxidative phosphorylation
svo00650  Butanoate metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo01130  Biosynthesis of antibiotics
svo01200  Carbon metabolism
Module
svo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
svo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVI_2736 (sdhB)
   00650 Butanoate metabolism
    SVI_2736 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SVI_2736 (sdhB)
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SVI_2736 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SVI_2736 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_16 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: BAJ02707
UniProt: D4ZM08
LinkDB All DBs
Position
complement(3102000..3102707)
Genome map
AA seq 235 aa AA seqDB search
MNLNIAVYRYNPDVDAKPYMKDYTLDVAEGTDMMVLDALILLKEQDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPVSTFKGKKIEIRPLPGMPVVRDIIVDLSQFYTQYEKIKPYLI
NDEKTPAREHLQSPEEREHLDGLYECIMCACCSTACPSFWWNPDKFIGPSGLLHAYRFLI
DSRDTATEERLSELDDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaatatcgcagtttatcgctataatcccgatgtagacgctaagccgtatatg
aaggattacacattagacgttgctgaaggtaccgatatgatggtccttgatgcactgata
ttgttgaaagagcaagatcctactttggcatttcgtcgttcatgtcgtgaaggtgtttgt
ggctcagatggcctaaacatgaatggcaagaacggtctggcctgtatcacgccagtttct
accttcaagggtaagaaaatcgagattagaccactgcctggaatgccagttgttcgtgac
ataattgtagacctgtctcagttctacactcagtatgagaagatcaagccctatctgatt
aacgatgagaaaacgcctgcgcgtgaacatctgcaatcacctgaggaacgtgaacactta
gatggtttatatgagtgtattatgtgtgcttgttgttctaccgcttgtccatctttttgg
tggaaccctgataagttcatcggtccaagcggcttgttacatgcctatcgcttcctaatc
gatagccgtgacacagcaaccgaagagcgtttatcggagctcgatgacgcctacagcgta
ttccgctgccatggcatcatgaactgcgtggatgtatgtcctaagggactcaatccgact
aaggcaattggacacattaagtccatgttgctgaagagagcagtgtaa

DBGET integrated database retrieval system