KEGG   Shewanella violacea: SVI_3012Help
Entry
SVI_3012          CDS       T01206                                 

Definition
(GenBank) hypothetical protein
Organism
svo  Shewanella violacea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2757
Motif
Other DBs
NCBI-ProteinID: BAJ02983
UniProt: D4ZAD8
LinkDB All DBs
Position
complement(3416906..3417628)
Genome map
AA seq 240 aa AA seqDB search
MNAIKSLLFIFLSLSVFDTQAMAISSLMLTNPDGQAGVFTLDNTDKITYFLKTSVSKVEI
IDNKIIKTPYTRENLDSWEIATKPSKLVIEPNMVKEIQVESICGAKCGTDRDRVYQINIQ
PVSYSTDGKEQSKIDMLFGFSPYYIVPAKESKIKYHLDYKGEIITAKNSGNTLINIVIDQ
CEKDAAKKSAKALCKANFTILAGRTRDVHVPKELQRGELNLMVLNHDETFREEITLPRGE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctattaaaagtttactgtttattttcttatccttatccgtgtttgatactcaa
gctatggcgatcagtagccttatgctaaccaatccagacggtcaggcaggggtgttcact
ttagataataccgataaaatcacctattttttgaaaacctcagtgtctaaagttgagatt
attgataataagattatcaagactccctataccagagagaatctagattcatgggagata
gcgactaagccatcgaaacttgtgattgaacctaatatggttaaagagatccaggttgaa
agtatctgtggcgctaagtgcgggaccgacagagatagggtctaccagatcaatattcaa
ccagtctcatacagcacagatggtaaagagcagtcaaaaattgatatgttgtttggtttc
tctccctactacatagtgccggctaaggagagcaaaattaaatatcatctcgattataaa
ggtgagattattacggcgaaaaatagcggcaataccttaataaatatcgtaatcgatcag
tgcgaaaaagatgctgctaagaagagcgctaaagctttatgcaaggcgaatttcaccatt
cttgcgggtcgaactagagatgtgcatgtaccaaaggagttgcagcgtggtgagcttaac
ttgatggtgctcaatcacgatgagacattcagggaagagattactttaccccggggagag
taa

DBGET integrated database retrieval system