KEGG   Shewanella violacea: SVI_3021Help
Entry
SVI_3021          CDS       T01206                                 

Definition
(GenBank) glutamate decarboxylase, putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
svo  Shewanella violacea
Pathway
svo00250  Alanine, aspartate and glutamate metabolism
svo00410  beta-Alanine metabolism
svo00430  Taurine and hypotaurine metabolism
svo00650  Butanoate metabolism
svo01100  Metabolic pathways
svo01110  Biosynthesis of secondary metabolites
svo01120  Microbial metabolism in diverse environments
svo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SVI_3021
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SVI_3021
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SVI_3021
   00430 Taurine and hypotaurine metabolism
    SVI_3021
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SVI_3021
Enzymes [BR:svo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SVI_3021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: BAJ02992
UniProt: D4ZAE7
LinkDB All DBs
Position
3428679..3430331
Genome map
AA seq 550 aa AA seqDB search
MSMTPRRATASEEALLRIFTVPEAPDSTLSVIEKNISQNLMGFLQESVVAVEKPLSEIEL
DFQQHQIPSAPQFVSDYADEMMKTLVAHSVHTSSPSFIGHMTSALPYFVLPLSKMMVGLN
QNLVKIETSKAFTPLERQVLGMMHHLIYSEDDKFYKNWMHSANYSLGAFCSGGTIANITA
LWTARNQLLKADGDFKGVSAQGLMKGLRHYGYDDLAILVSERGHYSLAKTADLLGIGRDN
IIQVPTSSDNKVDVDKMRAMAKQLDLDNIKVMAIVGVAGTTETGNIDPLDELATLAVELN
CHFHVDAAWGGASLLSNKYRHLLKGIERADSVTIDAHKQMYVPMGAGMVIFKDPAFANAI
KHHAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAEL
IHGQDDFQLVSEPELCLLTYRYVPKSVQEAMQETRESGNTEKLIEFNSLLDGLTKFVQKR
QREQGTSFVSRTRINPESRASLNIQSVVFRVVLANPLTTREILQQVLAEQIEIAQQDNEF
LPQLLALASN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgacacccagacgagccacagcttcggaagaggcattattgcgcatcttcaca
gtaccagaagcccctgattctacattaagcgtcatcgagaaaaacatatcgcaaaactta
atgggcttcttgcaagagagtgtggttgccgtcgaaaagcctttatctgagatagagcta
gatttccaacagcatcaaatcccctctgcgcctcagtttgtctcagactatgccgatgag
atgatgaagaccttagtggcgcactcggtgcatacgtcatcccctagctttattggtcat
atgacctcggctctgccttacttcgtcttacctctgtctaagatgatggtcgggcttaac
cagaatctggtaaaaattgagacctctaaagccttcacgccactggaacgtcaagtctta
ggcatgatgcatcacctgatctacagtgaagatgataagttttacaaaaactggatgcac
agcgccaactactccctcggagcattttgctcaggcggcactatcgctaacatcacagcc
ctatggactgcacgtaatcagctgctcaaggctgacggagatttcaagggcgtttcggct
caaggcctgatgaagggactgcgtcactatggctatgatgatttagccatcttagtctcc
gagcgtggtcactactcattggcgaaaacggcagacctgcttggcataggccgagataac
atcattcaggtgcccacatccagtgacaacaaggtcgatgttgataagatgcgcgccatg
gcgaaacagcttgatctggacaatatcaaggtaatggccatagtcggtgttgctggcacc
acagaaacaggcaatatcgaccccttagacgaacttgccacactggctgtagagcttaat
tgccatttccacgtcgatgcggcttggggcggcgcctcattattatccaacaagtaccgc
cacctgcttaaaggcatagaacgcgccgactctgtgacaatcgatgctcacaaacagatg
tatgtgcccatgggtgcgggtatggtgattttcaaagacccagcctttgccaacgccatc
aaacaccacgccgaatacatattacgcaagggttctaaagacctgggaagtcaaactctg
gagggatcgcgtcctgggatggccatgctggtccatgcttgcctgcagatcattggccga
gatggttacgagattttaatcaataacagtctggagaaggcacgttatttcgccgaacta
atccatggccaagatgacttccagctggtatctgagcccgaactctgtctgctcacctat
cgctatgtgcctaaatcggtacaagaggcgatgcaagagacaagagagagtggtaacact
gagaagttaattgaatttaatagcttactcgacggcctgactaagtttgtccagaaacgt
caacgagaacaaggcacctcatttgtttcccgtactcgtattaaccctgagagccgcgca
agtctgaatatccaatctgtggtgtttcgagtagtactggctaatcccctcaccacccgt
gagatattgcagcaggtcttagccgagcagatagagatagcccaacaagataacgagttc
ttaccgcaactcttggctctcgcctctaactaa

DBGET integrated database retrieval system