KEGG   Shewanella violacea: SVI_3581Help
Entry
SVI_3581          CDS       T01206                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
svo  Shewanella violacea
Brite
KEGG Orthology (KO) [BR:svo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SVI_3581 (ahpF)
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SVI_3581 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO HI0933_like NAD_binding_7 NAD_binding_8 Thi4 FMO-like AlaDh_PNT_C K_oxygenase Glutaredoxin FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAJ03552
UniProt: D4ZC07
LinkDB All DBs
Position
complement(4052161..4053738)
Genome map
AA seq 525 aa AA seqDB search
MLDTNLKNQLKTYLQNLKRPVELVVSADDSPKALELKSLAQDIDSLSELISVSEVQGERM
PSMKVTSAETDTSITFAGLPMGHEFTSLILALLHTGGHPLKLDDSVIAQIKALPGEYHFE
TYVSLSCQNCPDVVQALNMMAAVNPKITNVMIDGALFQTEVFDRDILAVPSVYLNGKLFS
QGRISLAEVLNKLDTGAAGRQAEQLAQKDVFDMLVVGGGPAGASAAIYSARKGLNTGVVA
DKFGGQVAETVAIENFISVKATEGPKLVANLESHVREYDVDVMDNQLGVKLTPSQGPNPY
HELLLENGATLKSQTLLLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVIG
GGNSGIEAAIDLANIVEHVTVLEFDIQLRADDVLQRKAASMNNITIITQAMTTQVLGDGS
RVNGLNYTDRATGEQHSVELAGIFVQIGLVPNTEWLKGVVDLTPRGEIIVDERGQTSVPG
IFAAGDVTNTPYKQIIIAMGSGATASLGAFDYLIRHSVPEQANAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctggatacgaatcttaaaaatcaactgaaaacctatctgcaaaacctcaagcgtcca
gttgaacttgtcgtgtctgcagatgatagccctaaggcactggaacttaagtcactggcc
caagatatcgatagtttgtctgaattaatctcagtgtcagaagttcaaggtgaacgtatg
ccatcgatgaaggtgacaagtgccgaaactgatacaagtataacgttcgctggtttgccc
atgggccatgaatttacctcgttaatattggccttgttacatactggcggtcacccactc
aagttagatgatagtgtcatcgctcagataaaggcgttacccggcgaatatcattttgag
acctatgtttctctaagctgccaaaattgccccgatgtggttcaggctttgaatatgatg
gctgcagttaatcctaaaattaccaatgtgatgatagacggtgctctatttcagaccgaa
gttttcgatcgagatattctagctgtgccttcggtatatcttaatggcaaattattttcc
cagggacgcatcagtttagctgaggttttaaataagttagacacgggagctgcgggtcgt
caggccgagcaattggctcaaaaagatgtgttcgacatgttagtggttggcggcggtccc
gctggtgcttctgctgctatctactcggcgagaaaaggcctaaatacaggtgtagttgcc
gataagtttggtggccaagtggctgaaaccgtagcaatcgagaattttatatcagtcaag
gcgactgagggacctaagctggtggctaatcttgagtcccatgtacgtgagtacgatgtc
gacgtgatggacaatcaactcggtgttaagttgactccaagccaaggacccaatccttat
catgaattactgcttgaaaatggtgcgacattaaaaagtcagaccttactactggctacc
ggtgcgcgctggcgtgagatgaatgttcccggcgagcaagagtatcgaggtaagggtgta
gcttattgtccacattgtgatggccccttgttcaaaggcaagcgtgtcgctgtgatcggc
ggtggtaactcaggtatcgaagcggcaatcgacttggccaatatcgttgagcatgtgacc
gtactggaatttgatattcaacttagagccgatgatgtgctgcagcgcaaggctgcctct
atgaataatatcaccataatcactcaagccatgaccacccaagtactgggtgatgggtca
agagtcaatgggcttaactacacagatagagccacgggtgagcaacatagtgttgagcta
gccggtatcttcgtgcagattggcttggtgcctaacactgaatggcttaaaggtgtggta
gatctaacgcctagaggcgagatcattgtcgatgagcgtggtcaaacatcggttcctggc
atatttgctgcgggggatgtgaccaacactccttataaacagataatcatcgccatgggc
agtggcgcgacagcctcattaggggccttcgattacttaattcgacatagcgtacccgag
caagctaacgccgcttaa

DBGET integrated database retrieval system