KEGG   Streptomyces vietnamensis: SVTN_00985Help
Entry
SVTN_00985        CDS       T03586                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SVTN_00985
Enzymes [BR:svt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SVTN_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 DUF4159
Motif
Other DBs
NCBI-ProteinID: AJF63296
UniProt: A0A0B5HS43
LinkDB All DBs
Position
197660..199645
Genome map
AA seq 661 aa AA seqDB search
MDIRRLTDRLGGLAFGGDYNPEQWDAEVWKQDDELMRRARVNLATVGVFSWALMEPEEGR
HDFDWLDAHLDRLHAAGVAVDLATPTASPPPWFTLAHPDALPVGPDGARLTHGSRDTYCL
AAPAYRRAARRIAGALAARYGDHPALALWHVHNEYVTLCFCDHAAAAFRVWLRARHGSLD
ALNEAWGTNFWSQRYTSWEQILPPRKSQWHRNPGQALDYNRFWSDETLAAYREQRDAIRA
HSDRPVTTNLMLPGYQNLDLWAFGREVDLVSVNHYPDAPGVDAAAHAAFDADRARSFAGG
APWLLMESGTNTVYAGGRVLAKDPGDILRHSLGHIARGSEGALFFQWRQSRAGAETWHSA
MVPHAGPDSRTFREVTAAGEAVARLGELAGSTVRAEVAVLHDSDAWWAMQVDGLPSSELD
YIAPLRRAHRALWDAGPTIDFAHPEHDLSRYRVVLAPALFLLTDAGAENLRRYVADGGTL
LVQHFGGIVDERLHARLGGYPAAPLREALGIRVEEHRPLRQDEEVTLSDGSTAGSWSESL
RTEGAEVLAAYTHGMLAGSPALTRHDFGSGHGLYLSTRLDDADYAALVRRLLAEAGVAPE
LPGLPPGVEAVTRHAPDGRGWHVLLNHLDEAVPLPRPAHDLLTDATVSRLPAGGCAVLRK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggacatccgccggctcaccgaccgcctgggcggcctagccttcggcggggactacaac
cccgagcagtgggacgcggaggtgtggaagcaggacgacgagctcatgcgccgggcgcgc
gtcaacctggccaccgtcggcgtcttctcctgggccctgatggaacccgaggagggacgc
cacgacttcgactggctcgacgcccacctcgaccggctgcacgcggccggcgtcgccgtc
gacctggccacccccaccgcctccccgccgccctggttcaccctggcccacccggacgcc
ctgccggtcggccccgacggcgcccgcctgacccacggcagccgggacacctactgcctc
gccgcccccgcctaccgccgggccgcccgccgcatcgccggcgccctcgccgcacgctac
ggcgaccacccggcgctcgccctgtggcacgtgcacaacgagtacgtcaccctctgcttc
tgcgaccacgccgcggccgccttccgggtctggctgcgcgcccgccacggctccctggac
gccctcaacgaggcctgggggacgaacttctggagccagcgctacacctcgtgggagcag
atcctgccgccccgcaagagccagtggcaccgcaaccccggccaggccctggactacaac
cgcttctggtccgacgagaccctcgccgcctaccgcgagcagcgcgacgccatccgcgcc
cacagcgaccggccggtgaccaccaacctgatgctgcccggctaccagaacctggacctg
tgggcgttcggccgcgaggtcgacctggtctcggtcaaccactaccccgacgcacccggc
gtcgacgccgccgcccacgccgccttcgacgccgaccgggcccgctccttcgccggcggg
gccccctggctgctgatggaatcgggcaccaacaccgtctacgccggcggccgcgtcctc
gccaaggatccgggggacatcctgcgccactcgctcggccacatcgcccgcggctcggag
ggcgcgctgttcttccagtggcgccagtcccgggccggcgccgagacgtggcactcggcg
atggtcccgcacgccgggccggacagccgcaccttccgcgaggtcacggcggccggggag
gccgtcgcccggctcggcgaactcgccggctccaccgtacgggccgaggtcgccgtgctg
cacgactccgacgcctggtgggccatgcaggtcgacgggctcccctcgtccgagctcgac
tacatcgccccgctgcgccgcgcccaccgggcgctgtgggacgccggaccgaccatcgac
ttcgcccaccccgagcacgacctgagccgctaccgggtcgtcctcgcgccggccctgttc
ctgctcaccgacgcgggcgccgagaacctgcgccgctacgtcgccgacggcggcaccctg
ctcgtccagcacttcggcggcatcgtcgacgagcgcctgcacgcccggctcggcgggtac
ccggccgccccgctgcgcgaggcgctgggcatccgcgtcgaggaacaccgcccgctgcgg
caggacgaggaggtcacgctctccgacggctcgacggccgggtcctggagcgagtccctg
cgcaccgagggcgcggaggtgctcgccgcctacacccacggcatgctcgccggaagcccg
gcgctcacccgccacgacttcggctccggccacggtctgtacctctccacccgcctcgac
gacgccgactacgccgccctggtccgccggcttctcgcggaggccggcgtcgccccggag
ctgccgggccttccccccggcgtcgaagccgtcacccggcacgccccggacggccgcggc
tggcacgtactcctcaaccacctcgacgaggccgtaccactcccccggccggcccacgac
ctgctcacggacgccaccgtgagccggctgcccgccggcggctgcgccgtcctgcgcaaa
ttgtga

DBGET integrated database retrieval system