KEGG   Streptomyces vietnamensis: SVTN_04075Help
Entry
SVTN_04075        CDS       T03586                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00020  Citrate cycle (TCA cycle)
svt00480  Glutathione metabolism
svt01100  Metabolic pathways
svt01110  Biosynthesis of secondary metabolites
svt01120  Microbial metabolism in diverse environments
svt01130  Biosynthesis of antibiotics
svt01200  Carbon metabolism
svt01210  2-Oxocarboxylic acid metabolism
svt01230  Biosynthesis of amino acids
Module
svt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVTN_04075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SVTN_04075
Enzymes [BR:svt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SVTN_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJF63746
UniProt: A0A0B5HTG4
LinkDB All DBs
Position
complement(944965..947184)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVTVETRDISLAGRIIAVFPEFLEEGQ
RIADALSELGDLAKTPGANIIKLPNVSASIPQLKAAIAELQAQGYALPDYPDDPQTDQDK
DVRARYDKIKGSAVNPVLREGNSDRRAPGSVKNYAKTHPHRMGAWTPESKTNVATMSEND
FASTEKSTVIAKDDTLRFEFAAADGTVSELREPLKVIAGEVVDAAVMRAAALRTFLGEQV
SRAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPNTFAKYGEALAAAGLSPNDGLGTV
LGGLDALPNGAEIKASFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDHSYSGVYQAVIEDCRAHGAFDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIAQAGTVRLIDSEGNVVLEQEVAEGDIFRACQTKDLPIQDWVKLAVTRARATGA
PAVFWLDENRAHDAQLIAKVKQYLPEHDTEGLDIKILSPVEATKFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALAASFEHLATSTGNTRAQVLADTLDRATGTFLNEDKSPTRRLGGIDNRGSHFY
LALYWAQELAAQTEDAELAKAFAPLAETLTANEQKIVDELIAVQGSPADIGGYYQPDPAK
AAAVMRPSATFNEAIASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacccacactgacgaggcgcccgccctggcgacgtac
tcgttcctgcccgtggtccaggcgtatgcctcgcaggccggcgtcacggtcgagacgcgt
gacatctccctcgcgggccgcatcatcgccgtcttccccgagttcctggaggagggccag
cgcatcgccgacgccctctccgagctcggcgacctggccaagacgcccggcgccaacatc
atcaagctgccgaacgtctcggcgtccatcccgcagctcaaggccgcgatcgccgagctc
caggcgcagggctacgccctcccggactacccggacgacccgcagacggaccaggacaag
gacgtccgcgcccgttacgacaagatcaagggctcggccgtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgcgccgggctcggtcaagaactacgccaagacccacccgcac
cgcatgggcgcctggacccccgagtccaagacgaacgtcgccacgatgagcgagaacgac
ttcgcctccacggagaagtccaccgtcatcgccaaggacgacaccctccgcttcgagttc
gccgccgccgacggcaccgtcagcgagctccgcgagccgctgaaggtcatcgccggcgag
gtcgtcgacgccgccgtcatgcgcgccgccgccctgcgcaccttcctcggcgagcaggtc
tcccgcgccaaggccgagggcgtgctcttctccgtgcacctcaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtcgtccgcgccttcttcccgaacaccttcgcg
aagtacggcgaggcgctcgccgccgccggcctgtccccgaacgacggcctcggcaccgtc
ctgggcggcctcgacgccctcccgaacggcgccgagatcaaggcctccttcgaggccgag
ctcgccgagggccccgccctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtcatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggaggccgacaccctcgcggtcctcccggaccacagctac
tccggcgtgtaccaggccgtcatcgaggactgccgcgcccacggcgccttcgacccgtcg
accatgggctccgtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcgcccaggccggcaccgtccgcctgatcgactccgagggc
aacgtcgtcctggagcaggaggtcgccgagggcgacatcttccgcgcctgccagaccaag
gacctgcccatccaggactgggtcaagctggccgtcacccgcgcccgcgccaccggcgcc
ccggccgtcttctggctggacgagaaccgcgcccacgacgcgcagctcatcgccaaggtc
aagcagtacctgccggagcacgacaccgagggcctggacatcaagatcctctccccggtc
gaggccaccaagttctccctggagcgcatccgccgcggcgaggacaccatctccgtcacc
ggcaacgtcctgcgcgactacctgaccgacctcttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggccggcggcggcctcttcgagaccggcgcc
ggcggctccgccccgaagcacgtccagcagctcgtcaaggagaactacctccgctgggac
agcctcggcgagttcttcgccctggccgcctccttcgagcacctcgcgaccagcacgggc
aacacccgcgcccaggtcctcgccgacaccctcgaccgcgccaccggcaccttcctcaac
gaggacaagtcgccgacccgccgcctcggtggtatcgacaaccgcggcagccacttctac
ctggccctgtactgggcccaggagctggccgcccagaccgaggacgcggagctggccaag
gccttcgccccgctcgccgagacgctcaccgccaacgagcagaagatcgtcgacgagctg
atcgccgtccagggctccccggccgacatcggcggctactaccagcccgacccggccaag
gccgcggccgtgatgcgcccgtccgccacgttcaacgaggccatcgcgtccctcgcctga

DBGET integrated database retrieval system