KEGG   Streptomyces vietnamensis: SVTN_08725Help
Entry
SVTN_08725        CDS       T03586                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00061  Fatty acid biosynthesis
svt00780  Biotin metabolism
svt01100  Metabolic pathways
svt01130  Biosynthesis of antibiotics
svt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SVTN_08725
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SVTN_08725
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SVTN_08725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:svt01004]
    SVTN_08725
Enzymes [BR:svt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SVTN_08725
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SVTN_08725
Lipid biosynthesis proteins [BR:svt01004]
 Fatty acid synthase
  Component type
   SVTN_08725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AJF64492
UniProt: A0A0B5I1Z7
LinkDB All DBs
Position
complement(1986201..1986977)
Genome map
AA seq 258 aa AA seqDB search
MSGILEGKRILITGVLMESSIAFHAAKLAQEQGAEIILTAWPRPTLTERIAKKLPHPDKV
KVLELDVSNDEHLARLEGQVREHLGDRLDGIVHSIGFAPQDALGGNFLNTPFESVATAMH
VSAFSLKSLTMALLPLMSEGGSVVGLTFDAQFAWPQYDWMGPAKAALEATSRYMARDLGK
QNIRCNLISAGPLGSMAAKSIPGFGELASVWDTRSPLEWDLADPEPAGRGIVALLSDWFP
KTTGEIIHVDGGLHAIGA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaattctcgagggcaagcgcatcctcatcaccggtgtgctgatggagtcctcc
atcgccttccacgccgcgaagctggcccaggagcagggtgcggagatcatcctcaccgcc
tggccccggccgacgctgaccgagcgcatcgccaagaagctgccccaccccgacaaggtg
aaggtcctggagctcgacgtctccaacgacgagcacctcgcccgcctggagggccaggtc
cgcgagcacctgggcgaccgcctcgacggcatcgtgcactccatcggcttcgcgccgcag
gacgcgctcggcggcaacttcctgaacacgccgttcgagtccgtggccaccgccatgcac
gtctccgccttctccctgaagtcgctgacgatggcgctgctgccgctgatgtccgagggc
ggttcggtcgtcggcctgaccttcgacgcgcagttcgcctggccgcagtacgactggatg
ggcccggccaaggccgccctggaggccaccagccgctacatggcgcgcgacctcggcaag
cagaacatccgctgcaacctgatctcggcgggcccgctcggctccatggccgcgaagtcc
atcccgggcttcggcgagctggcctcggtctgggacacccgctccccgctggagtgggac
ctcgcggacccggagccggccggccgcggcatcgtcgcgctgctctcggactggttcccg
aagaccacgggcgagatcatccacgtcgacggcggtctgcacgccatcggcgcgtaa

DBGET integrated database retrieval system