KEGG   Streptomyces vietnamensis: SVTN_09495Help
Entry
SVTN_09495        CDS       T03586                                 

Definition
(GenBank) uridine kinase
Organism
svt  Streptomyces vietnamensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AJF69636
UniProt: A0A0B5IAT1
LinkDB All DBs
Position
complement(2156508..2157143)
Genome map
AA seq 211 aa AA seqDB search
MRYEAITWDRLAETLAGHLDASPAAAGDDWLKVGIDGPPAAPGGELAGLLAEALRSRGRA
VQVVSTGGFLRPASLRYEYGRQDPDAYYSGWTDTGALWREVFGPLDPGGTGRVLPDLWDP
VTDRATRSPYVTLPPRGVLVLHGPFLLGHWFPFDLTVHLRLSPGALARRTEESWTLPAFA
RYEMEVGPTEAADAVVRADDPRHPAWTGLRT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacgaggcgatcacctgggaccggctggcggagacgctcgccggtcacctcgac
gcgtcccccgccgctgcgggcgacgactggctcaaggtgggcatcgacggtccgcccgcc
gcgcccggcggcgaactcgccgggctcctcgccgaagcgctgcgctcgcgcgggcgggcg
gtccaggtcgtgagcaccggcggcttcctgcgacccgcttcccttcggtacgagtacggg
aggcaggaccccgacgcgtactacagcgggtggaccgacaccggggccctgtggcgggag
gtcttcgggccgctggaccccggcggcaccgggcgcgtgctgcccgacctctgggacccg
gtcacggaccgcgccacccgcagcccgtacgtcacgctgccgccgcgcggggtgctcgtg
ctgcacgggcccttcctgctcggccactggttccccttcgacctcaccgtgcacctgcgc
ctctcgcccggcgccctcgcccggcgcacggaggagtcctggaccctgcccgccttcgcc
cggtacgagatggaggtcggccccaccgaggcggcggacgccgtcgtgcgcgccgacgac
ccgcgccacccggcctggacgggcctgcggacgtag

DBGET integrated database retrieval system