KEGG   Streptomyces vietnamensis: SVTN_10835Help
Entry
SVTN_10835        CDS       T03586                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00500  Starch and sucrose metabolism
svt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SVTN_10835
Enzymes [BR:svt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SVTN_10835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AJF64853
UniProt: A0A0B5I5D7
LinkDB All DBs
Position
complement(2463623..2465311)
Genome map
AA seq 562 aa AA seqDB search
MARKTVAAALALVAGAAVAVTGNAPAQAAPPGVKDVTAVMFEWNFASVARECTDRLGPAG
YGYVQVSPPQEHLQGSQWWTSYQPVSYKIAGRLGDRTAFKNMIDTCHAAGVKVVADSVIN
HMANGSGTGTGGTPFSKYDYPGLYSGADMDDCRATISNYQDRANVQNCELVQLPDLDTGE
DYVRGKIAGYLNDLASLGVDGFRIDAAKHMPATDLANIKSRLTNPNVFWKQEAIYGAGEA
VQPSEYLGNGDVQEFRYARDLKRVLQNEKLAYLKNFGEAWGYMPSDRSGVFVDNHDTERG
GDTLNYKDGANYTLASVFMLAWPYGSPDVHSGYEWTDKDAGPPNNGQVNACYTDGWKCQH
AWREISSMVAFRNTARGQAVTDWWDNGNNAIAFGRGSKAYVAINHESSALTRTFQTSLAA
GTYCDVQSNTPVTVGTNGQFTATLAANTAVALHTGAMNCGTTQPATAGASFNVNATTVTG
QNIYVTGNRAELGNWAPASALKLDPAAYPVWKLTVNLPAGTAFEYKYLRKDAAGNVTWES
GANRTATVPVSGQIVLNDTFRN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagaccgtggccgctgcactcgccctcgtggcgggagccgctgtggccgtc
acgggcaacgccccggcgcaggccgccccgcccggcgtgaaggacgtcaccgcggtgatg
ttcgaatggaacttcgcctccgtcgcccgggagtgcaccgaccgcctcggccccgccgga
tacggatacgtccaggtctccccgccccaggaacacctccagggcagccagtggtggacc
tcgtaccagccggtcagctacaagatcgccggacgcctcggcgaccgcaccgccttcaag
aacatgatcgacacctgccacgcggcgggggtcaaggtcgtcgccgactccgtcatcaac
cacatggcgaacggatcgggcacgggaacgggcgggaccccgttctccaagtacgactac
cccggcctctactcgggcgccgacatggacgactgccgggccaccatctccaactaccag
gaccgcgccaacgtccagaactgcgaactggtccagctccccgacctcgacacgggcgag
gactacgtccgcgggaagatagccggctacctcaacgacctggcctccctcggcgtcgac
ggcttccgcatcgacgccgccaagcacatgccggccaccgacctcgccaacatcaagtcg
cgcctgacgaacccgaacgtcttctggaagcaggaggccatctacggcgccggcgaggcc
gtccagcccagcgagtacctcggcaacggcgacgtccaggagttccgctacgcccgcgac
ctcaagcgcgtcctgcagaacgagaagctcgcctacctcaagaacttcggcgaggcctgg
ggctacatgccctccgaccggtccggcgtcttcgtcgacaaccacgacaccgagcgcggc
ggcgacaccctcaactacaaggacggcgcgaactacaccctcgcctccgtcttcatgctc
gcctggccctacggctccccggacgtccactccggctacgagtggaccgacaaggacgcg
ggcccgcccaacaacggtcaggtgaacgcctgctacaccgacggctggaagtgccagcac
gcctggcgcgagatctcctccatggtggccttccgcaacaccgcccgcgggcaggccgtc
accgactggtgggacaacggcaacaacgcgatcgcgttcggccgcggctccaaggcgtac
gtggcgatcaaccacgagtcctccgccctcacccgcaccttccagacctccctcgccgcc
ggcacctactgcgacgtgcagtcgaacaccccggtcaccgtcggcacgaacggccagttc
accgccaccctcgccgcgaacaccgccgtcgccctccacaccggcgccatgaactgcggc
accacccagcccgccaccgccggcgcgtccttcaacgtcaacgccaccacggtcaccggc
cagaacatctacgtcaccggcaaccgcgccgagctcggcaactgggcccccgcctccgcc
ctcaagctcgacccggccgcgtaccccgtctggaagctgacggtgaacctgcccgccgga
acggccttcgagtacaagtacctccgcaaggacgcggccgggaacgtgacctgggagtcc
ggtgccaaccgcaccgcgaccgtgcccgtctcgggccagatcgtcctgaacgacaccttc
cgcaactga

DBGET integrated database retrieval system