KEGG   Streptomyces vietnamensis: SVTN_15475Help
Entry
SVTN_15475        CDS       T03586                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00620  Pyruvate metabolism
svt00680  Methane metabolism
svt01100  Metabolic pathways
svt01120  Microbial metabolism in diverse environments
svt01200  Carbon metabolism
Module
svt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SVTN_15475
  09102 Energy metabolism
   00680 Methane metabolism
    SVTN_15475
Enzymes [BR:svt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SVTN_15475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJF65601
UniProt: A0A0B5HYZ0
LinkDB All DBs
Position
complement(3507962..3510691)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTSTASTELRADIRRLGDLLGETLVRQEGHELLDLVEKVRRLTREDGEAAAELLR
GVELETAAKLVRAFSTYFHLANVTEQVHRGREMREKRAAEGGLLARTADMLKDGDPEHVR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVSQSERRRTDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLAAELERVGVELPSGTRPLTFGTW
IGGDRDGNPNVTPQVTWDVLILQHEHGITDALELVDFLRGLLSNSIRYTGATQELLDSLQ
RDLELLPEISPRYKRLNAEEPYRLKATCIRQKLVNTRERLAHGTPHQDGRDYLGTAELIR
DLTLIQTSLREHRGALFADGRMERVIRTLSAFGLQLATMDVREHAEAHHHALGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTIKESFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLIDLHGGWAKIGIVPLLETTDELKAADVILDDML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHTAYRRLVEDPDLPAYFFAATPVDQLADLH
LGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDAVLGEMH
ERWGFFRNFLSNVEMTLAKTDLRIARHYVDTLVPENLKHVFDTIEAEHALTVAEVLKVTG
GEKLLDSNPVLQQTFAIRDAYLDPISYLQVALLARQRAAAERGEDPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacctccaccgccagcaccgagctgcgcgccgacatccgccga
ctgggcgatcttctcggcgagaccctcgtgcgccaggaaggccacgaactcctcgacctc
gtcgagaaggtccgccgcctcacccgcgaggacggcgaggccgccgccgagctgctccga
ggcgtcgaactcgagacggccgccaagctcgtgcgcgccttctccacctacttccacctc
gcgaacgtcaccgagcaggtccaccgcggccgcgagatgcgcgagaagcgcgccgccgag
ggcggcctcctcgcccgcaccgccgacatgctcaaggacggcgaccccgagcacgtccgc
gagaccgtcaagaacctcaacgtacggcccgtcttcaccgcgcaccccaccgaagccgcc
cgccgttccgtcctcaacaagctccgccgcatcgccgccctcctggagaccccggtcagc
cagtccgagcggcgccgcaccgacctgcggctcgccgagaacatcgacctcatctggcag
accgacgaactccgggtcgtccgccccgagcccgccgacgaggcccgcaacgccatctac
tacctcgacgagctgcacgccaacgccgtcggcgacgtcctggaggacctcgccgccgaa
ctggagcgcgtcggcgtcgaactgccctccggcacccgccccctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtgacctgggacgtcctg
atcctccagcacgagcacggcatcaccgacgccctcgaactcgtcgacttcctccgcgga
ctgctctccaactccatccgctacaccggagccacccaggaactcctggactccctccag
cgcgacctggaactcctccccgagatcagcccccgctacaagcgcctcaacgccgaggag
ccctaccggctcaaggccacctgcatccggcagaagctcgtcaacacccgcgagcgcctc
gcccacggcaccccccaccaggacggccgcgactacctcggcaccgccgaactcatccgc
gacctcaccctcatccagacctccctgcgcgagcaccgcggcgccctcttcgccgacggc
cgcatggaacgggtcatccgcaccctctccgccttcggcctccagctcgccaccatggac
gtccgcgaacacgccgaggcccaccaccacgccctcggccagctcttcgaccgcctcggc
gaggagtcctggcggtacgccgacatgccccgcgactaccggcagaagctcctcgccaag
gaactccgctcccgccgccccctcgcccccaccccggccccgctcgacgccgccggcgag
aagaccctcggcgtcttccacaccatcaaggagtccttcgagcgcttcggccccgaggtc
atcgagtcgtacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccgccgtc
ctcgcccgcgaggccggcctcatcgacctgcacggaggctgggccaagatcggcatcgtg
ccgctcctggagaccaccgacgagctcaaggccgccgacgtcatcctcgacgacatgctc
gccgacccctcctaccggcgcctcgtctcgctccgcggcgacgtccaggaggtcatgctc
ggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccaccgc
gcccagcgccgcctccgcgacgtcgcccaccgctacggcgtccgcctgcgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcgcacgacgcgatcctcgcccag
ccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtacctgatcccgtcgctggcccgcgagaacctggaactgacggtcgccgccacgctc
caggcctccgccctgcacaccgccccgcgccagtccgacgaggccctcgcccgctgggac
gcggccatggacaccgtctccgacgccgcccacaccgcgtaccgcaggctcgtcgaggac
cccgacctccccgcgtacttcttcgccgccacccccgtcgaccagctcgccgacctccac
ctcggctccaggccctcccgccggcccgactccggcgcgggactcgacggactccgcgcc
atcccctgggtgttcggctggacccagtcccgccagatcgtccccggctggtacggcgtc
ggctccggcctcaaggccctgcgcgaggccggcctcgacgccgtcctcggcgagatgcac
gagcggtggggcttcttccgcaacttcctctccaacgtggagatgacgctcgccaagacg
gacctgcggatcgcccgccactacgtcgacaccctggtccccgagaacctcaagcacgtc
ttcgacaccatcgaggccgaacacgcgctgaccgtcgccgaggtcctcaaggtcaccggc
ggcgagaagctcctcgactccaacccggtcctccagcagaccttcgccatccgcgacgcc
tacctggacccgatctcctacctccaggtcgccctcctcgcccgccagcgcgcggccgcc
gagcgcggcgaagacccggacccgctgctcgcacgggccctgctcctcaccgtgaacggc
gtggccgcgggcctccgcaacaccggctga

DBGET integrated database retrieval system