KEGG   Streptomyces vietnamensis: SVTN_25525Help
Entry
SVTN_25525        CDS       T03586                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
svt  Streptomyces vietnamensis
Brite
KEGG Orthology (KO) [BR:svt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SVTN_25525
Enzymes [BR:svt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SVTN_25525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AJF67237
UniProt: A0A0B5I9Y0
LinkDB All DBs
Position
complement(5642021..5642416)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYLANEDPHFRARATVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPELNQLVNDTLKALSAAKASTDPKTGEKALELIAE
IDRIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgtttgcccccaaggtgaaggtcagcgcccactgcgacctcccgtgc
ggcgtgtacgaccccgcccaggcccgcatcgaggccgagtccgtcaaggctgtccaggag
aagtacctggccaacgaggacccgcacttccgtgcgcgcgccacggtcatcaaggagcag
cgcgcggagctcgccaagcaccacgtctcggtgctctggagcgactacttcaaggccccg
cacttcgagaagtaccccgagctcaaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtcgaccgacccgaagacgggcgagaaggcgctggagctcatcgccgag
atcgaccgcatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system