KEGG   Streptomyces vietnamensis: SVTN_25630Help
Entry
SVTN_25630        CDS       T03586                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00020  Citrate cycle (TCA cycle)
svt00310  Lysine degradation
svt00380  Tryptophan metabolism
svt01100  Metabolic pathways
svt01110  Biosynthesis of secondary metabolites
svt01120  Microbial metabolism in diverse environments
svt01130  Biosynthesis of antibiotics
svt01200  Carbon metabolism
Module
svt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SVTN_25630 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    SVTN_25630 (kgd)
   00380 Tryptophan metabolism
    SVTN_25630 (kgd)
Enzymes [BR:svt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SVTN_25630 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJF67255
UniProt: A0A0B5HZB6
LinkDB All DBs
Position
complement(5666723..5670532)
Genome map
AA seq 1269 aa AA seqDB search
MSSQSPSTPSSPADQDGQGVSPAAAFGANEWLVDEIYQQYLQDPNSVDRAWWDFFADYKP
GASETPAAPAPTTTQSAPVAPQAGPAQAAPSAPAAVPAPAPAPVAAPAPAPAPVKPAAAP
APVAAKPAAAAPAAVKAAPAAPAKEAPAGPELITLRGPAAAVAKNMNASLEVPTATSVRA
VPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNYSFAEKDGKPTLVK
PEHVNFGLAIDLVKPNGDRQLVVAGIKKAETLNFFEFWQAYEDIVKRARVGKLTMEDFSG
VTVSLTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMTLTS
TYDHRVIQGAASGEFLRVVANFLLGEEGFYDEIFKALRIPYEPVRWLKDIDASHDDDVTK
AARVFELIHSYRVRGHVMADTDPLEYKQRKHPDLDITEHGLTLWDLEREFAVGGFAGKSM
MKLRDILGVLRDSYCRTTGVEFMHIQDPKQRKWIQDRVERPHSRVEREEQLRILRRLNAA
EAFETFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAESRLDEVVIGMAHRGRLNVLANI
VGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQIKVSLTANPSHLEAVD
PVLEGVVRAKQDVINKGGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYRTGGTVHI
VINNQVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQTFNKD
VVIDLICYRRRGHNEGDNPQFTNPQMYNLIDKKRSVRKLYTESLIGRGDITLEEAEQALQ
DFQGQLEKVFAEVREATAAPASATVPDAQAEFPVAVTTAVSQEVVKRIAESQVNVPERIT
VHPRLMPQMQRRAASIDDGTIDWGFGETLAIGSLLMEGTPVRLSGQDSRRGTFGQRHAVL
VDQETGEDYTPLLYLTEDQAHYNVYDSLLSEYAAMGFEYGYSLARPDSLVIWEAQFGDFV
NGAQTVVDEFISSAEQKWGQTSGVTLLLPHGYEGQGPDHSSARPERFLQMCAQDNMTVAM
PTLPSNYFHLLRWQVHNPHHKPLIVFTPKSMLRLKAAASKVEEFTTGGFRPVIGDTTVNP
ADVRKVVFCAGKVYYDLEAERQKRGDTETAIIRLERLYPLPGAELQAEIAKYPNAAKYIW
AQEEPANQGAWPFIALNLIDHLDLAVGADIPAGERLRRISRPHSSSPAVGSAKRHQAEQQ
QLVNEVFDA
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtctcagtcccccagtaccccgagctccccggccgaccaagacgggcagggcgtg
agccccgcagccgccttcggtgccaatgagtggctcgtcgacgagatctaccagcagtac
ctccaggacccgaattcggtcgatcgtgcctggtgggacttcttcgccgactacaagccc
ggagcgtcggagaccccggccgccccggcccccaccaccactcagagcgcgccggtcgcg
ccgcaggcgggccccgcacaggccgcgccttcggctcccgcggccgttccggcccccgcg
cccgccccggtcgcggccccggctcctgctccggctcccgtgaagccggccgcggccccc
gcgccggtcgccgcgaagccggccgccgccgctccggccgccgtcaaggccgccccggcc
gccccggcgaaggaggcccccgccggccccgagctgatcacgctgcgcggccccgccgcc
gcggtcgcgaagaacatgaacgcctccctggaggtgccgacggccacgtccgtccgcgcc
gtcccggtgaagctgctcttcgacaaccggatcgtgatcaacaaccacctgaagcgcgcc
cggggcgggaagatctccttcacgcacctcatcggctacgcgatggtgcaggcgatcaag
gccatgccgtcgatgaactactccttcgcggagaaggacggcaagccgaccctggtcaag
ccggagcacgtgaacttcggcctcgcgatcgacctggtcaagcccaacggcgaccgccag
ctcgtcgtcgcgggcatcaagaaggccgagacgctcaacttcttcgagttctggcaggcc
tacgaggacatcgtcaagcgcgcccgcgtgggcaagctgacgatggaggacttctccggc
gtcacggtctccctgaccaaccccggcggcctcggcaccgtccactccgtgccgcgtctg
atgcccggtcagtccgtcatcatgggcgtcggctcgatggactacccggccgagttccag
ggcacctcccaggacaccctgaacaagctgggcatctcgaaggtcatgaccctgacctcg
acgtacgaccaccgcgtcatccagggcgccgcctccggcgagttcctgcgcgtcgtcgcc
aacttcctcctcggcgaggagggcttctacgacgagatcttcaaggccctgcgcatcccc
tacgagccggtccgctggctcaaggacatcgacgcctcgcacgacgacgacgtcaccaag
gccgcgcgcgtcttcgagctcatccactcctaccgggtccgcggccacgtcatggccgac
accgacccgctggagtacaagcagcgcaagcaccccgacctggacatcaccgagcacggc
ctcaccctgtgggacctggagcgggagttcgcggtcggcggcttcgccggcaagtcgatg
atgaagctccgcgacatcctcggcgtgctccgcgactcgtactgccgcaccaccggcgtc
gagttcatgcacatccaggacccgaagcagcgcaagtggatccaggaccgcgtcgagcgc
ccgcactcccgcgtggagcgcgaggagcagctgcggatcctgcgccggctgaacgcggcg
gaggccttcgagaccttcctgcagacgaagtatgtcggccagaagcgcttctcccttgag
ggcggcgagtccgtcatcccgctgctcgacgcggtcatcgactcggccgccgagtcgcgc
ctcgacgaggtcgtcatcggcatggcccaccgcggccgcctgaacgtcctggcgaacatc
gtcggcaagtcgtacgcgcagatcttccgcgagttcgagggcaacctcgacccgaagtcg
atgcacggctccggcgacgtcaagtaccacctgggcgccgagggcaccttcaccggcctg
gacggcgagcagatcaaggtctcgctcaccgccaacccctcgcacctggaggcggtcgac
ccggtcctggagggtgtcgtccgcgccaagcaggacgtcatcaacaagggcggcacggac
ttcaccgtcctgcccgtcgccctccacggcgacgcggccttcgccggccagggcgtcgtc
gccgagacgctgaacatgtcgcagctgcggggctaccgcaccggcggcacggtccacatc
gtcatcaacaaccaggtcggcttcaccgccgccccggagtcctcgcgttcctcgatgtac
gcgaccgacgtggcccgcatgatcgaggcgccgatcttccacgtgaacggcgacgacccg
gaggccgtggtccgcgtcgcgcggctcgccttcgagttccgccagacgttcaacaaggac
gtcgtgatcgacctcatctgctaccgccgccgcggtcacaacgagggcgacaacccgcag
ttcaccaacccgcagatgtacaacctgatcgacaagaagcgttcggtgcgcaagctgtac
accgagtcgctcatcggtcgcggcgacatcaccctcgaagaggcggagcaggcgctccag
gacttccagggccagctggagaaggtgttcgcggaggtccgcgaggccaccgccgccccg
gcgtcggccaccgtgccggacgcgcaggccgagttcccggtcgccgtcaccaccgcggtc
tcccaggaggtcgtgaagcggatcgccgagtcgcaggtcaacgtcccggagcggatcacg
gtccacccgcgtctgatgccgcagatgcagcgccgcgccgcctccatcgacgacggcacc
atcgactggggcttcggcgagaccctcgccatcggctccctgctgatggagggcaccccg
gtccgcctgtcgggccaggactcccgccgcggcaccttcggccagcgccacgcggtcctg
gtcgaccaggagaccggcgaggactacaccccgctgctctacctgaccgaggaccaggcc
cactacaacgtctacgactcgctgctcagcgagtacgcggcgatgggcttcgagtacggc
tactcgctggcccgcccggactccctggtcatctgggaggcccagttcggtgacttcgtc
aacggcgcgcagaccgtcgtcgacgagttcatctcctcggccgagcagaagtggggccag
acctccggcgtcacgctgctcctgccgcacggctacgagggccagggcccggaccactcg
tccgcgcgcccggagcgcttcctccagatgtgcgcccaggacaacatgacggtcgccatg
ccgacgctgccgtcgaactacttccacctcctgcgctggcaggtccacaacccgcaccac
aagccgctcatcgtcttcaccccgaagtcgatgctgcgtctgaaggccgcggcgtccaag
gtggaggagttcaccaccggcggcttccgcccggtgatcggcgacacgacggtcaacccg
gccgacgtccgcaaggtcgtcttctgcgccggcaaggtctactacgacctggaggccgag
cgtcagaagcgcggtgacacggagaccgcgatcatccgtctggagcgcctgtacccgctg
ccgggtgccgagctgcaggccgagatcgccaagtacccgaacgccgcgaagtacatctgg
gcgcaggaggagccggcgaaccagggtgcctggccgttcatcgcgctcaacctgatcgac
cacctggacctggcggtcggcgcggacatcccggcgggcgagcgcctgcgccggatctcg
cgtccgcactcctcctccccggcggtcggctcggccaagcgccaccaggcggagcagcag
cagctggtcaacgaggtcttcgacgcctga

DBGET integrated database retrieval system