KEGG   Streptomyces vietnamensis: SVTN_26400
Entry
SVTN_26400        CDS       T03586                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00997  Biosynthesis of various secondary metabolites - part 3
svt01100  Metabolic pathways
svt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SVTN_26400
Enzymes [BR:svt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SVTN_26400
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AJF67383
UniProt: A0A0B5ICI3
LinkDB
Position
complement(5845755..5846738)
AA seq 327 aa
MTGYGHFARSLRLRRLYRHSTAGLMITPLDHSIHDGPVVPKGTTLDRLAAEIAAGGSDAV
VVHKGSVRHISPERFAAMSLIIHLNASTSQALDPNAKYVVAGVEEALRLGADAVSVHVNL
GSDDERQQIGDLGRIADACDRWNLPLLAMVYPRGPRISDPRDPAVVAHAVTIAADLGADL
VKTVFLGSTAEMLDLTAACPVPVLVAGGPALDEEEDVLAYVRDAIAGGAGGVAMGRNIFQ
AKDPRALAAKVARIVHHFPEQHFADGPFGAADGGDRLHGERLTPDHLDDARPEDPDHPTL
DHPTLDDSTLDDLTGGPHHDGRQTVLA
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccggttacggccacttcgcccggtcgctgcggctacggcggctctaccgccacagc
acggccggcctgatgatcactcctctcgaccactcgatccacgacggtccggtggtgccc
aagggcacgacgctcgaccggctcgccgccgagatcgccgccggcggctcggacgccgtc
gtcgtgcacaagggcagcgtgcgccacatcagcccggagcggttcgccgcgatgtcgctg
atcatccacctcaacgcgagcaccagccaggcgctcgaccccaacgccaagtacgtcgtc
gccggcgtggaggaggccctgcgcctgggcgcggacgcggtcagcgtccacgtcaacctc
ggctccgacgacgagcggcagcagatcggcgacctcggcaggatcgccgacgcctgcgac
cgctggaacctgccgctgctcgccatggtgtacccgcgcgggccgcggatcagcgacccg
cgggacccggcggtcgtcgcgcacgccgtgacgatcgccgcggacctgggcgcggacctg
gtcaagaccgtcttcctcggatccaccgcggagatgctcgacctgaccgcggcctgcccc
gtgccggtcctcgtcgcgggcggacccgccctcgacgaggaggaggacgtcctggcgtac
gtccgggacgccatcgccggcggggcgggcggggtggccatgggccgcaacatcttccag
gccaaggacccgcgcgccctggcggccaaggtcgcccggatcgtgcaccacttccccgaa
cagcacttcgcggacggcccgttcggcgcggcggacggaggggaccggcttcacggcgaa
cgcctcacccccgaccacctcgacgacgcccggcccgaagaccccgaccacccgaccctc
gaccacccgaccctcgacgactcgactctcgacgacctgacaggaggtccgcatcatgac
ggacgccaaactgtgctggcttga

DBGET integrated database retrieval system