KEGG   Streptomyces vietnamensis: SVTN_27005Help
Entry
SVTN_27005        CDS       T03586                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
svt  Streptomyces vietnamensis
Pathway
svt00473  D-Alanine metabolism
svt00550  Peptidoglycan biosynthesis
svt01100  Metabolic pathways
svt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:svt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SVTN_27005
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SVTN_27005
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SVTN_27005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:svt01011]
    SVTN_27005
Enzymes [BR:svt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SVTN_27005
Peptidoglycan biosynthesis and degradation proteins [BR:svt01011]
 Precursor biosynthesis
  Amino acid ligase
   SVTN_27005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AJF67480
UniProt: A0A0B5HZX9
LinkDB All DBs
Position
5988391..5989530
Genome map
AA seq 379 aa AA seqDB search
MSENTQSPRKPRVAVVFGGRSSEHAISVVTAGAVLSAIDRDKYDVLPIGITTDGRWALTA
DAPERMAITDRKLPNVAELAESEQGGVVLPVDPSSREVVLTEPGQVPTALGEVDVVFPML
HGPYGEDGTLQGLLELSGVPYVGAGVLASAVGQDKEYMKRVFTSFGLPVGPYEVIRPREW
EQNPAAARKKIVEFAADHGWPLFVKPARGGSSMGITKVDDLSGLDEAIEEARRHDPKILV
ESLLRGREIECGVLEFEDGPRASVPAEIPPVTNHDFYDFEAKYIDSASGIVPAPIGDEAT
AEVQRLAVLAYEAVSCEGLVRADFFLTEDGDFVINEINTMPGFTPISMYPRMWQESGVSY
PELVDRLIQAALTRSTGLR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacacccagagcccccgcaagccgcgcgtggccgtcgtcttcggcggtcgc
agctccgagcacgccatctccgtcgtcacggcgggcgccgtcctgagcgccatcgaccgg
gacaagtacgacgtgctgcccatcggcatcacgacggacgggcgctgggcgctcaccgcc
gacgcccccgagcggatggccatcaccgaccggaagctgcccaacgtcgccgaactggcc
gagtccgagcagggcggcgtcgtcctccccgtcgacccgtccagccgcgaggtcgtcctc
accgagccggggcaggtccccacggccctcggcgaggtcgacgtggtcttcccgatgctc
cacggcccctacggcgaggacggcaccctccagggcctcctggagctctccggcgtcccc
tacgtcggcgcgggcgtcctcgcctccgccgtcggccaggacaaggagtacatgaagcgg
gtcttcacctccttcggcctgccggtcggcccgtacgaggtcatccggccgcgcgagtgg
gagcagaaccccgccgccgcccgcaagaagatcgtcgagttcgccgccgaccacggctgg
ccgctcttcgtgaagccggcccgcggcggctcctccatgggcatcaccaaggtcgacgac
ctctccggcctggacgaggccatcgaggaggcccgccgccacgaccccaagatcctcgtc
gagtcgctgctgcgcggccgcgagatcgagtgcggcgtcctggagttcgaggacggcccg
cgcgccagcgtcccggccgagatcccgccggtcacgaaccacgacttctacgacttcgag
gccaagtacatcgactcggcctccggcatcgtgcccgcccccatcggggacgaggccacc
gccgaggtccagcgcctcgccgtgctcgcctacgaggccgtgtcctgcgagggcctggtc
cgcgccgacttcttcctcaccgaggacggcgacttcgtcatcaacgagatcaacaccatg
ccgggcttcacgcccatctccatgtacccgcgcatgtggcaggagagcggcgtgagctac
cccgagctcgtcgaccggctcatccaggccgcgctgacccgctccacgggcctgcgctag

DBGET integrated database retrieval system