KEGG   Streptomyces vietnamensis: SVTN_31170Help
Entry
SVTN_31170        CDS       T03586                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
svt  Streptomyces vietnamensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AJF68164
UniProt: A0A0B5IIC8
LinkDB All DBs
Position
complement(6937265..6938323)
Genome map
AA seq 352 aa AA seqDB search
MDLPVMPPVLPMLAKPVKRIPPGMQYEVKWDGFRAIVHRDGPELVIGSRTGRPLTRYFPE
LVEALAARLPERCVVDGEIVVEHDGRLDFDRLAERIHPADSRVRLLAETTPARFVAFDLL
ALGDDSLLDTPLSERRAALERVLDGVDAPVHLASATRDPELAARWFEQYEGAGLDGVIAK
PLDLPYRPDARLMYKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDEGVLQHVGVCAA
FTAARRAELVEELEPLRTDPSDGHPWAAWADEAAHEEARLPGAPSRWAGRRDLSWVALRP
ERVCEVGYDHMEGDRFRHTAQFKRWRPDRTPESCGYGQLDEPVSYDLAEILA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatctaccggtcatgccccctgtcctgcccatgctcgccaagcccgtgaagcggatc
ccgcccggcatgcagtatgaggtgaagtgggacggcttccgcgcgatcgtgcaccgggac
gggccggagctcgtcatcggcagccgtacgggcaggccgctcacccgctacttccccgag
ctggtcgaggcgctcgcggcccggctgccggagcgctgcgtcgtcgacggggagatcgtc
gtcgagcacgacgggcggctcgacttcgaccggctcgccgagcggatccatccggccgac
tcccgggtgcggctgctcgccgagaccaccccggcccggttcgtcgccttcgacctgctc
gccctcggggacgactcgctgctcgacaccccgctgagcgagcgccgggcggccctggag
cgggtcctcgacggggtcgacgcgcccgtccacctggcgtcggcgacccgggaccccgag
ctcgcggcgcgctggttcgagcagtacgagggcgccgggctcgacggggtgatagccaag
ccgctcgacctgccgtaccggccggacgcccgcctcatgtacaagatcaagcacgagcgg
acggccgatgtcgtcgtggccggataccgcttccacaagagcggccccgtggtcggctcg
ctgctgctcggcctgtacgacgacgagggcgtcctccagcacgtcggcgtgtgcgcggcc
ttcaccgcggcccgccgcgccgagctcgtcgaggagctggaaccgctccggacggacccg
tcggacgggcacccctgggcggcgtgggcggacgaggccgcgcacgaggaggccaggctg
ccgggcgcgccgagccgctgggcgggcaggagggacctgtcgtgggtggcgctgcggccg
gagcgggtctgcgaggtcggctacgaccacatggagggggaccgcttccgccacaccgcg
cagttcaagcggtggcgcccggaccggacgccggagtcctgcggctacgggcagctggac
gagcccgtctcgtacgacctggccgagatcctcgcgtaa

DBGET integrated database retrieval system