KEGG   Streptomyces vietnamensis: SVTN_38010Help
Entry
SVTN_38010        CDS       T03586                                 

Gene name
ligB
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
svt  Streptomyces vietnamensis
Pathway
svt03030  DNA replication
svt03410  Base excision repair
svt03420  Nucleotide excision repair
svt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:svt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SVTN_38010 (ligB)
   03410 Base excision repair
    SVTN_38010 (ligB)
   03420 Nucleotide excision repair
    SVTN_38010 (ligB)
   03430 Mismatch repair
    SVTN_38010 (ligB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:svt03032]
    SVTN_38010 (ligB)
   03400 DNA repair and recombination proteins [BR:svt03400]
    SVTN_38010 (ligB)
Enzymes [BR:svt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SVTN_38010 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     SVTN_38010 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SVTN_38010 (ligB)
DNA replication proteins [BR:svt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SVTN_38010 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SVTN_38010 (ligB)
DNA repair and recombination proteins [BR:svt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SVTN_38010 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     SVTN_38010 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     SVTN_38010 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: AJF69206
UniProt: A0A0B5I9K9
LinkDB All DBs
Position
8580182..8581729
Genome map
AA seq 515 aa AA seqDB search
MLLARVAEVSREVAATSARSRKIALLAELFAQAGPEESPLVIAYLSGRLPQGRIGVGWSI
LKGVVPPAVPPAERAALTLGQVDRTMAELAVVSGAGARGERTRLVHALMAAATHDEQELL
LRLLAGEVRQGALDAIALEGVARAAGVPAAELRRAVMLEGSLPPVAQAVLAEGAPGLDRF
TLRVGNPVQPMLAHTAGSVAEAIAALGACAVEEKLDGIRIQVHRRGDDVRVHTRSLDDIT
DRLPEVVATARAVAADAFILDGEVIALDPGTGRPVSFQSVAGRVGSRVDVAGAHAALPLT
PVFFDVLVVDGEGLIDRSGVERHAVLARLLPESQRVRRTVVLDPADPAQTEAAERFYADT
LARGREGVLVKALEAPYVAGRRGRTWLKVKPVRTVDLVVLAVERGHGRRTGLLSNLHLGA
RTADGGFAMLGKTFKGLTDEMLRWQTERLGELAVSDDGFTVRVRPELVVEVAYDGLQSST
RYPAGVTLRFARVVRYRPDKRASEADTVERITEGR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctccttgcgcgtgtcgcggaagtgtcccgggaggtcgccgcgacctccgcgcgctcg
cgcaagatcgctctgctggccgaactgttcgcccaggccgggcccgaggagagcccgctc
gtcatcgcgtatctgtccgggcggctgccgcaggggcggatcggggtcgggtggagcatc
ctcaagggcgtcgtcccgccggccgtgccgcccgccgagcgagccgctcttacgctcggg
caggtcgacaggacgatggcggagctggccgtcgtgtccggcgccggagcccgcggcgag
cggacccggctcgtccacgcgctgatggcggccgccacccacgacgaacaggaactgctg
ctgcggttgctggccggcgaggtgcgtcaaggagccctcgacgccatcgccctggagggc
gtcgcgcgggccgccggggtccccgccgccgaactgcggcgcgccgtgatgctcgaagga
tcgctgcccccggtcgcccaggccgtgctggccgagggtgcccccggcctcgaccggttc
acgctgcgggtcggcaaccccgtgcagcccatgctcgcgcacacggccggttccgtcgcc
gaggcgatcgccgccctgggggcgtgcgcggtcgaggagaagctcgacggcatacggatc
caggtgcaccggcgcggtgacgacgttcgcgtgcacacccgctcgctcgacgacatcacc
gaccgcctccccgaggtggtcgcgaccgcccgagccgtagcggccgacgcgttcatcctg
gacggcgaggtgatcgccctcgatcccggcacggggcgcccggtgtccttccagtcggtg
gccggccgggtcggctcccgcgtcgacgtcgccggtgcgcacgcggcccttcctctcacg
ccggtcttcttcgacgtcctcgtggtggacggcgaaggcctgatcgaccggtcgggagtg
gagcggcacgccgtcctcgcccgactgctgccggagtcccagcgggtccgccgcacggtc
gtcttggatccggccgatcccgcgcagaccgaggccgccgagcggttctacgcggacacc
ctggcccggggacgcgagggcgtgctggtcaaggcgttggaggcgccctacgtggccggt
cgcagggggcgcacctggctgaaggtgaaacccgtccgcaccgtcgacctcgtcgtgctc
gccgtggagcggggccacggccgcagaaccgggctgctctccaacctccacctcggcgcg
cggaccgccgacggaggcttcgccatgctcggcaagaccttcaaggggctcacggacgag
atgctccgctggcagaccgagcggctcggcgaactcgccgtgtcggacgacggattcacc
gtgcgcgtgcggcccgagctcgtcgtggaggtcgcgtacgacgggctccagtcctcgacg
cgctacccggcgggtgtcacgctccgcttcgcccgggtcgtgcgctaccgccccgacaag
cgggcctcggaggccgacaccgtcgagcggatcaccgaaggacgctga

DBGET integrated database retrieval system