KEGG   Streptomyces violaceoruber: B1H20_07980Help
Entry
B1H20_07980       CDS       T05124                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00500  Starch and sucrose metabolism
svu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B1H20_07980
Enzymes [BR:svu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B1H20_07980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: ARF61357
UniProt: A0A1V0U8C1
LinkDB All DBs
Position
complement(1802888..1804618)
Genome map
AA seq 576 aa AA seqDB search
MARRPLSAALALVAGAAALVVPTGLGAASPALAAAPGDKDVTAVMFEWKFASIAKACTDT
LGPAGYGYVQVSPPQEHIQGGQWWTSYQPVSYRIAGRLGDRAAFSAMVNTCHSAGVKVVA
DSVINHMAAGNGTGTGGSAYTKYDYPGLYSGADMDDCRSQINNYNDRGNVQNCELVGLAD
LDTGEDYVRGRIAGYLNDLLSLGVDGFRIDAAKHMPAADLAAIKSRLTNPNVYWKQEAIH
GAGEAVSPSEYLGTGDVQEFRYGRSLKQVFLNENLAHLKNFGEGWGFMESGKSGVFVDNH
DTERGGDTLNYRHGSAYTLATVFMLAYPYGSPDVHSGYEFSDHDAGPPNGGQVNACYSEG
WKCQHAWREISSMVGFRNAARGQGVTDWWDNGGDQIAFGRGNKAYVAINHEGSALNRTFQ
TSLPAGDYCDVQSGKGVTVNGSGRFTATVPAGAAVALHANARTCSGGGTDPGPGPGNGSS
GASFGVNATTQLGQNIHVTGDQAALGNWNPANAPKLDPATYPVWKLDVNLPAGTTFAYKY
VRKDASGNVTWESGANRTATVPASGKVTLTADVWRG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggcccctgtccgccgcgctcgccctcgtggccggcgccgccgccctcgtc
gtccccaccggactcggcgcggcgtcccccgcgctggccgccgctccgggcgacaaggac
gtcaccgccgtgatgttcgagtggaagttcgcctccatagccaaggcgtgtacggacacc
ctcggcccggcgggctacggctacgtccaggtctcgccgccccaggagcacatccagggc
ggccagtggtggacctcgtaccagcccgtcagctaccggatcgccggccggctcggtgac
cgggccgccttctccgccatggtcaacacgtgtcactcggcgggcgtgaaggtcgtcgcc
gactccgtcatcaaccacatggcggcgggcaacggcaccggcaccggaggctccgcgtac
accaagtacgactacccgggcctctactccggcgccgacatggacgactgccggtcgcag
atcaacaactacaacgaccgcggcaacgttcagaactgcgaactggtcggcctcgccgat
ctggacaccggcgaggactacgtacgcggcaggatcgccgggtacctcaacgacctgctc
tcgctcggcgtggacggcttccgcatcgacgccgcgaagcacatgcccgccgccgacctg
gccgccatcaagtcccggctgaccaacccgaacgtctactggaagcaggaggcgatccac
ggggcgggggaagccgtctcgccctccgaatacctcggcaccggggacgtccaggagttc
cgttacgggcggagcctcaagcaggtcttcctcaacgagaacctcgcccacctgaagaac
ttcggtgagggctggggcttcatggagtccggcaagtccggcgtcttcgtcgacaaccac
gacaccgagcggggcggcgacaccctgaactacagacacggctccgcctacaccctcgcc
accgtcttcatgctggcctacccctacggctccccggacgtccactccggctacgagttc
agcgaccacgacgccgggcctcccaacggcggccaggtcaacgcctgctacagcgagggc
tggaagtgccagcacgcctggcgcgagatctcctccatggtcggcttccgcaacgcggcg
cgcggccagggagtcaccgactggtgggacaacggcggcgaccagatcgccttcgggcgg
ggcaacaaggcgtacgtcgcgatcaaccacgagggctccgcgctgaaccggaccttccag
acctcgctgcccgccggcgactactgcgacgtccagtccggcaagggcgtcaccgtcaac
ggctccggccggttcaccgccaccgtcccggccggcgccgccgtcgccctgcacgcgaat
gcccggacctgctccgggggcggcaccgaccccggcccggggccgggcaacggctcctcc
ggcgcctccttcggcgtcaacgccaccacgcagctcggccagaacatccacgtcaccggt
gaccaggccgccctcggcaactggaacccggcgaacgcgccgaagctcgacccggcgacg
tacccggtctggaagctggacgtgaacctgcccgccgggaccacgttcgcctacaagtac
gtccgcaaggacgcttccggcaacgtcacctgggagagcggcgccaaccgcaccgccacc
gtcccggcctccggcaaggtcacgctgaccgccgacgtctggcgcggctga

DBGET integrated database retrieval system