KEGG   Streptomyces violaceoruber: B1H20_12945Help
Entry
B1H20_12945       CDS       T05124                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00620  Pyruvate metabolism
svu00680  Methane metabolism
svu01100  Metabolic pathways
svu01120  Microbial metabolism in diverse environments
svu01200  Carbon metabolism
Module
svu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:svu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1H20_12945
  Energy metabolism
   00680 Methane metabolism
    B1H20_12945
Enzymes [BR:svu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B1H20_12945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF615 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARF62207
UniProt: A0A1V0UAS8
LinkDB All DBs
Position
complement(3023144..3025873)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPAASPALRADIRRLGDLLGETLVRQEGQELLDLVERVRALTRTDGEAAAELLG
DTDLETAAQLVRAFSTYFHLANVTEQVHRAHEMRDRRSAEGGLLARTADRLKDADPDHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAELLETPVIEADRRRLDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLAAELERVGVELPAGTRPLTFGTW
IGGDRDGNPNVTPAVTWDVLILQHEHGITDALEMIDQLRGLLSNSIRYAGATEELLASLQ
NDLDRLPGISPRYKRLNAEEPYRLKATCIRQKLVNTRERLAEGTPHRPGCDYLGTAELLA
DLELIQTSLREHRGGLFADGRMDRTIRTLAAFGLQLATMDVREHADAHHHTLGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPPPPPLDAAGEKTLGVFHTIKEAFERFGPEV
IESYIISMCQGADDVFAATVLAREAGLLDLHAGWAKIGIVPLLETTDELKAADVILDAML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHHAYRKLVEDPDLPAYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEMN
EHWHFFRNFISNVEMTLAKTDLRIARHYVDTLVPDELKHVFDAIEAEHALTVSELLRITG
GQKLLDTNPVLQQTFSIRDAYLDPISYLQVSLLARQRQAAENDEEPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccctgccgccagccccgcgctgcgcgccgacatccgccgc
ctcggcgacctcctcggcgaaaccctcgtccgccaggagggacaggaactcctcgacctc
gtcgaacgggtccgcgccctgacccgcaccgacggcgaagccgccgccgagctcctcggc
gacacggacctggagaccgccgcacaactcgtacgcgccttctccacctacttccacctc
gccaacgtcaccgagcaggtccaccgcgcccacgagatgcgcgaccgccgctccgccgaa
ggcggcctcctggcccgcaccgccgaccgcctcaaggacgccgaccccgaccacctgcgc
gaaacggtcaagaacctcaacgtccggcccgtcttcaccgcccaccccaccgaggccgcc
cgccgctccgtcctcaacaagctccgccgcatcgccgaactcctggaaaccccggtcatc
gaggccgaccgccgccgcctcgacctccgcctcgccgagaacatcgacctcatctggcag
accgacgaactccgcgtcgtccgcccggaacccgccgacgaggcccgcaacgccatctac
tacctcgacgaactccacgccggcgccgtcggagacgtcctggaagacctcgccgccgaa
ctcgaacgcgtcggcgtcgaactccccgcaggcacccgccccctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtcacccccgccgtcacctgggacgtcctc
atcctccagcacgaacacggcatcaccgacgccctggagatgatcgaccagctccgcgga
ctcctctccaactccatccgctacgccggagccaccgaggaactcctcgcctccctccag
aacgacctcgaccgactccccggcatcagcccccgctacaagcggctcaacgccgaggag
ccctaccggctcaaggccacctgcatccgccagaagctcgtcaacacccgcgaacgcctc
gccgaaggcaccccccaccgccccggctgcgactacctcggcaccgccgaactcctcgcc
gacctggaactcatccagaccagcctccgcgaacaccgcggcggcctcttcgccgacggc
cgcatggaccgcaccatccgcaccctcgccgccttcggcctccagctcgccaccatggac
gtacgcgaacacgccgacgcccaccaccacaccctcggccagctcttcgaccggctcggc
gaggaatcctggcgctacgccgacatgccccgcgactaccggcagaagctcctcgccaag
gaactccgctcccgccgccccctcgcccccccccccccccccctcgacgcggccggcgag
aagaccctcggcgttttccacaccatcaaggaagccttcgaacgcttcggacccgaagtc
atcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccaccgtc
ctcgcccgtgaagccggactcctcgacctccacgccggctgggccaagatcggcatcgtc
ccgctcctggaaaccaccgacgagctcaaggccgccgacgtcatcctcgacgccatgctc
gccgacccctcctaccgccgcctcgtctccctgcgcggcgacgtccaggaggtcatgctc
ggctacagcgactcctccaagttcggcggcatcaccaccagccagtgggaaatccaccgc
gcccagcgccgcctccgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttccac
ggccgcggcggcaccgtcggccgaggcggcggcccctcccacgacgccatcctcgcccag
ccctggggcaccctcgaaggcgagatcaaggtcaccgaacagggcgaggtcatctccgac
aagtacctcatccccgccctcgcccgcgaaaacctcgaactcaccgtcgccgccaccctc
caggcatccgcactccacaccgcaccccgccagtccgacgaagccctcgcccgctgggac
gcggccatggacaccgtctccgacgccgcccaccacgcctaccgcaagctcgtcgaagac
cccgacctgcccgcctacttcctcgcctccacccccgtcgaccagctcgccgacctgcac
ctcggctcacggccctcccgccgccccggctccggcgtctccctcgacggcctccgcgcc
atcccctgggtcttcggctggacccagtcccgccagatcgtccccggctggttcggcgtc
ggctccggcctcaaggccctgcgcgaagccggactcgacaccgtcctcgacgagatgaac
gagcactggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgccaagacc
gacctgcgcatcgcccgccactacgtcgacaccctcgtccccgacgagctcaagcacgtc
ttcgacgccatcgaagccgaacacgccctcaccgtcagcgaactcctgcgcatcaccggc
ggccagaagctgctcgacaccaacccggtgctccagcagaccttctccatccgcgacgcc
tacctggaccccatctcctacctccaggtatccctgctcgcccgccagcgccaggccgcc
gagaacgacgaagagcccgacccgctcctcgcccgcgccctgctcctcaccgtcaacggc
gtcgccgccggactccgcaacaccggctga

DBGET integrated database retrieval system