KEGG   Streptomyces violaceoruber: B1H20_19655Help
Entry
B1H20_19655       CDS       T05124                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00250  Alanine, aspartate and glutamate metabolism
svu00410  beta-Alanine metabolism
svu00430  Taurine and hypotaurine metabolism
svu00650  Butanoate metabolism
svu01100  Metabolic pathways
svu01110  Biosynthesis of secondary metabolites
svu01120  Microbial metabolism in diverse environments
svu02024  Quorum sensing
Module
svu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:svu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    B1H20_19655
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1H20_19655
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1H20_19655
   00430 Taurine and hypotaurine metabolism
    B1H20_19655
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    B1H20_19655
Enzymes [BR:svu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B1H20_19655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARF63342
UniProt: A0A1V0UED9
LinkDB All DBs
Position
complement(4494488..4495915)
Genome map
AA seq 475 aa AA seqDB search
MPLHRGAHPEQDEPSDERRRLALNPFYGEADPTAAMHTAPPRHRLPDGPLPPLTAYRLVH
DELMLDGNSRLNLATFVTTWMEPQADVLMSECRDKNMIDKDEYPRTAELERRCVAMLADL
WNAPDPQTAVGCSTTGSSEACMLAGMALKRRWTRRNADRYPAKAKPNLVMGVNVQVCWEK
FCDFWEVEARQVPMEGDRFHLDPRAAVELCDENTIGVIGVLGSTFDGSYEPIAELCAALD
DLQERTGLDVPVHVDGASGAMVAPFLDPDLEWDFRLPRVASINTSGHKYGLVYPGVGWVL
WRAAAALPEELVFRVNYLGGEMPTFALNFSRPGAQVVAQYYTFLRLGHEGYRAVQQASRD
VACGLARAVEGLGDFRLLTRGDQLPVFAFTTKDDVHAYDVFDVSRRLRERGWLVPAYTFP
ADRQDLSVLRVVCRNGFSSDLAELLIEDLKLLLPELRSQRHPLSQDRPVPTAFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccaccgcggtgcccacccggagcaggacgagccctccgacgagcggcgcagg
ctcgcgctgaacccgttctacggcgaggccgacccgacggccgcgatgcacaccgcgccg
ccgcgccaccggctgccggacggaccgctgccgccgctgaccgcgtaccgcctggtccac
gacgagctgatgctcgacggcaactcccggctcaacctggccacgttcgtcaccacgtgg
atggagccgcaggcggacgtcctgatgagcgagtgccgggacaagaacatgatcgacaag
gacgagtacccgcgcaccgccgaactggagcggcgctgcgtggcgatgctcgcggacctg
tggaacgcccccgatccgcagacggccgtggggtgttcgaccaccgggtccagcgaggcg
tgcatgctcgcggggatggcgttgaagcgccgctggacccggcggaacgcggaccgctat
ccggcgaaggcgaagcccaatctggtgatgggcgtcaacgtgcaggtctgctgggagaag
ttctgcgacttctgggaggtggaggcccggcaggtcccgatggaaggcgaccgcttccac
ctcgacccgcgggcggccgtcgaactgtgcgacgagaacaccatcggcgtgatcggcgtc
ctcggctccaccttcgacggctcctacgagccgatcgcggagctgtgcgcggcgctggac
gacctccaggaacgcaccggcctcgatgtcccggtccacgtggacggggcgtccggcgcg
atggtggcgcccttcctcgacccggatctggagtgggacttccggctgccgagggtggcg
tcgatcaacacgtcgggccacaagtacgggctcgtctacccgggcgtcggctgggtgctg
tggcgggcggcggcggcgctgccggaggagctggtcttccgggtcaactacctgggcggc
gagatgcccacgttcgcgctgaacttctcgcggcccggggcgcaggtggtcgcgcagtac
tacacgttcctgcgcctcgggcacgagggctaccgggcggtccagcaggcgtcccgggac
gtggcctgcgggctggcgcgcgcggtggagggactgggcgacttccgactcctcacccgg
ggcgaccagttgccggtgttcgccttcacgacgaaggacgacgtccacgcgtacgacgtc
ttcgacgtgtcgcgccggctgcgcgaacggggctggctggtccccgcgtacaccttcccg
gccgaccgccaggacctgtcggtgctgcgggtggtatgccgcaacggtttctcctcggac
ttggccgagctgctgatcgaggacctgaaactactgctgcccgaactccgctcccaacgc
cacccgttgagccaggaccggccggtgccgaccgcgttccaccactga

DBGET integrated database retrieval system