KEGG   Streptomyces violaceoruber: B1H20_22165Help
Entry
B1H20_22165       CDS       T05124                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00564  Glycerophospholipid metabolism
svu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1H20_22165
Enzymes [BR:svu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B1H20_22165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ARF63785
UniProt: A0A1V0UEV9
LinkDB All DBs
Position
5009792..5011498
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPVERVESLAAMAARELDVLVVGAGVVGAGTALDAATRGLTTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPVHRHLSRKRALRVAPALRKDALVGALQYYDAQMDDARF
VTELVRTAASYGAHVANRARVTGFLREGERVVGALVQDTEGGREYAIRAKQVVNATGVWT
DDTQGLIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNAVLSTPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAACVTEDTPLVGAEGYKAL
WNARARIADRTGLHVVRVEHLLNRYGSMTEQILELILADPALGEPLPAADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARLCAELMAPVLGWDQERIDQEVEHYEKRV
EAERESQLQPDDLTADAARLGAPDIVPG
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgtcgagcgcgtcgaatcgctcgccgccatggccgcg
cgcgaactggacgtgctggtcgtgggggcgggcgtggtcggcgcgggcacggcgctggac
gccgccaccagaggtctgacgaccgggctggtcgaggcgcgcgactgggcgtccggcacc
tccagcaggtcgagcaagctgatccacggcggtctgcgctatctggagatgctcgacttc
gccctggtccgcgaggccctcaaggagcgcggcctgctcctggagcggctcgccccgcac
ctggtgaagcccgtgcccttcctctaccccttgcagcacaagggctgggagcggctctac
gccggctccggcgtggcgctctacgacgcgatgtcggtctcctccggccacgggcgcggc
ctgcccgtccaccgccacctctcccgcaagcgcgccctccgggtggcccccgccctgcgc
aaggacgccctggtcggcgccctccagtactacgacgcccagatggacgacgcccgcttc
gtcaccgagctggtgcgcaccgccgcctcctacggggcccacgtggcgaaccgggcgcgg
gtcaccggcttcctccgcgagggggagcgggtcgtgggcgcgctcgtccaggacaccgag
ggcggccgggagtacgcgatccgggccaaacaggtggtcaacgccaccggcgtgtggacc
gacgacacccaggggctcatcggcgagcgcggccagttccacgtccgcgcctccaagggc
atccacctggtcgtccccaaggaccgcatccactcctcgaccggcctgatcctgcgcacc
gagaagtccgtcctcttcgtcatcccctgggggcggcactggatcatcggcaccacggac
accgactgggatctggacaaggcccatccggccgcctccagcgccgatatcgactacctc
ctggagcatgtcaacgccgtcctcagcaccccgctgaccagggacgacgtgcagggcgtc
tatgccgggctgcgtccgctgctggccggcgagtcggacgccaccagcaagctgtcccgc
gagcacacggtggcccacccggccccggggctcgtcgtcgtggcgggcggcaagtacacg
acgtaccgggtcatggcgaaggacgcggtcgacgaggcggtgcacggcctcgaccagcgg
gtcgccgcctgcgtcaccgaggacaccccgctggtgggcgccgaggggtacaaggccctg
tggaacgcgcgggcccggatcgcggaccgcaccggcctccacgtcgtccgggtggagcat
ctgctcaaccggtacggctcaatgaccgagcagattctggagctgatcctcgccgacccc
gccctcggcgagccgctgcccgccgccgacgactacctgcgcgccgaggtcgtctacgcg
gcctcccacgagggcgcccgccatctcgacgacgtcctgacccggcgcacccggatctcc
atcgagaccttcgaccggggtacccgcagcgcccggctctgcgcggagctgatggccccg
gtgctgggctgggaccaggagcggatcgaccaggaggtcgagcactacgagaagcgggtg
gaggccgagcgcgaatcgcagctccagcccgacgacctgacggcggacgccgcccggctc
ggcgccccggacatcgtgccgggctga

DBGET integrated database retrieval system