KEGG   Streptomyces violaceoruber: B1H20_31850
Entry
B1H20_31850       CDS       T05124                                 

Definition
(GenBank) alkaline phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
svu  Streptomyces violaceoruber
Pathway
svu00521  Streptomycin biosynthesis
svu01100  Metabolic pathways
svu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B1H20_31850
Enzymes [BR:svu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     B1H20_31850
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-ProteinID: ARF65498
UniProt: A0A1V0UKM8
LinkDB
Position
complement(7304478..7305830)
AA seq 450 aa
MKCRVLGSAPYTRQALAGAALLIAGTVMGPAAASSGDERDTSRARNVILLVGDGMGDSEI
TLARNYTVGAGGRLHMDGFPMTGSYTTYSVDRDGRPNYVTDSAASATAWATGHKTVNDRI
SKTADTDRAVPTILELARQGGLATGSVTSAELTDATPAALTSHVTDRSCQGPADMERCPT
DTRAAGGPGSIAEQTVAHRVDVLLGGGRQRFDQTITQGPERGSTVLQRARQHGYRVVTDA
RGLDAVRPGRPVLGLFAPEELPVAWTGTPAAAGGTAPQRCVTDREPSDGIPSLEVLTRKA
IALLDARARQKGAGKGFFLQVEGAAIDKQNHDADPCGQIGETVAFDRAVKAAREYAARHP
DTLVITTADHGHSSQIVPMAARPAGLSATLITDEGAPMKVSYATHAGEEGQEHSGVQVRI
AAEGPEAHRVLGTTDQTQLFTTLRIGLNLR
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaaatgcagggtactggggagcgccccttacacgcggcaagccttggcgggcgccgca
ctgctcatcgccggcaccgtgatggggcccgccgcagcgtcgagcggagacgaacgggac
acctcgcgggcacgcaacgtgatcctgctggtcggtgacggcatgggcgactccgagatc
accctcgcgcgcaactacaccgtcggcgcgggcgggaggctccacatggacggtttcccc
atgaccgggtcgtacaccacctactcggtggaccgcgacggacgtcccaactacgtcacc
gactccgccgccagcgccacagcctgggccaccggccacaagacggtgaacgaccggatc
tccaagacggccgacaccgaccgcgccgtgcccacgatcctggagctcgcccggcaaggc
ggactcgccaccggcagcgtcaccagcgccgagctgacggacgccacccccgccgccctc
acctcgcacgtcaccgaccgcagttgccagggcccagccgacatggagcggtgcccgacg
gacacgcgggcggcgggcggcccgggctccatcgccgagcagacggtcgcccaccgcgtc
gacgtcctcctcggcggtggcaggcaacgcttcgaccagaccatcacccagggtccggag
cgtggctccacggtgctgcagcgtgcgcgtcagcacggctatcgcgtggtgacggacgcc
aggggcctggacgccgtccgccccggacgcccggttctgggccttttcgcaccggaggag
ctgccggtcgcctggaccggaacgccggccgcggccggcggcaccgcaccacagcgctgc
gtgaccgaccgcgaaccctccgacggcatcccgagtctggaggtgctgacgcgcaaggcc
atcgcgctgctggatgcccgagcacgccagaagggcgcggggaaggggttcttccttcag
gtcgaaggcgccgccatcgacaagcagaatcacgatgccgacccctgcggccagatcggt
gagaccgtcgccttcgaccgagccgtcaaagccgccagggagtacgccgcacggcaccct
gacaccctcgtcatcaccaccgccgaccacgggcacagcagtcagatcgtgcccatggcg
gccaggcccgcaggactctccgcgacgctgatcacggacgagggcgccccgatgaaggtc
agctacgccacgcacgcgggcgaggagggacaggagcacagcggcgtacaggtacgcatc
gcggccgaggggcccgaggcgcacagagtgctcggcaccacggaccagacccaactgttc
accactctccgcatcggtctcaacctgcggtga

DBGET integrated database retrieval system