KEGG   Staphylococcus warneri: A284_06570Help
Entry
A284_06570        CDS       T02449                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
swa  Staphylococcus warneri
Pathway
swa00020  Citrate cycle (TCA cycle)
swa00310  Lysine degradation
swa00380  Tryptophan metabolism
swa01100  Metabolic pathways
swa01110  Biosynthesis of secondary metabolites
swa01120  Microbial metabolism in diverse environments
swa01130  Biosynthesis of antibiotics
swa01200  Carbon metabolism
Module
swa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A284_06570 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    A284_06570 (sucA)
   00380 Tryptophan metabolism
    A284_06570 (sucA)
Enzymes [BR:swa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A284_06570 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N DUF1840
Motif
Other DBs
NCBI-ProteinID: AGC90631
UniProt: L7WWX4
LinkDB All DBs
Position
1405338..1408142
Genome map
AA seq 934 aa AA seqDB search
MTKDKREVTEAPVNFGANLGLMLDLYDDYLQDPSSVPEDLQVLFSTIQTGEAHIEAKPAA
NEGGSQSGDSTIKRVMRLIDNIRQYGHLKANIYPVNPPERKNIPKLEIEDFDLDQATLEN
ISAGIVSEHFTDIYDNAYEAIVRMEKRYKGPIAFEYTHINNNKERVWLKRRIETPYKATL
NNKQKTELFNKLAHVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQHTITLAGEAGIKNIQ
IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTAGWTGDVKYHLGGVK
TTDSYGIEQRIALANNPSHLEIVAPVVEGRTRAAQDNTQQAGAPQTDFHKAMPIIIHGDA
AYPGQGINFETMNLGDLKGYSTGGSLHIITNNRIGFTTEPTDGRSTTYSTDVAKGYDVPI
LHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITNPLPYHNIRK
HDSVELVYGKKLVDEGIISEDEMNQVIDSVQKEMRAAHDKIDKSDKMDNPDMEKPESLQQ
PLKSDDKEFTFDHLKEINDAMLTYPEGFNVLKKLNKVLEKRKEPFEKEDGLVDWAQAEQL
AFATILQDGTSIRLTGQDSERGTFSHRHAVLHDEENGDTFTPLHHVPDQKASFDIHNSPL
SEAAVVGFEYGYNVENKGSFNIWEAQYGDFSNMAQMMFDNFLSSARAKWGERSGLTLFLP
HSFEGQGPEHSSARLERFLQLAAENNSTVVNLSSASNYFHLLRAQAASLDSQEMRPLIVM
SPKSLLRNKTVAKPINEFTTGGFKPIIAEDYEANKVKKVILASGKVFIDLKEYLAKNPDE
SVLLVAVERLYPFPEEEIQEIFDQLPNLESVSWVQEEPKNQGAWLFVYPYLRSLVGDKYD
LSYHGRIQRAAPAEGDGEIHKLVQNNIIESSITK
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggacaagagagaagttacagaggcacctgtaaacttcggcgcaaatctaggg
ttaatgctagatttatacgatgattacctacaagatccatcatctgtacccgaagattta
caagtcctatttagtacaattcaaacaggggaagctcatatcgaagctaaaccagccgct
aatgagggtggttcacaatctggtgacagtacaattaaacgtgtcatgagattaatcgat
aacattagacaatacggacatttaaaagcaaatatatatccagtcaatcctccagagcgt
aaaaatatacctaaattagaaatagaagatttcgatttagatcaagctactttggaaaat
atctcagctggaatcgtatcagaacattttactgatatttacgataatgcatatgaagct
attgttcgtatggaaaaaagatataaaggtcctattgcgttcgaatatacgcatattaat
aacaataaagaacgtgtatggttaaaacgtcgtatcgaaacaccatataaagcaacatta
aataataaacaaaaaactgaattatttaataaattggctcatgtcgaaggtttcgagaaa
tatttacacaaaaacttcgttggtgcaaaacgattctctattgagggcgtcgatgcttta
gtaccaatgctacaacacacgattacactagctggtgaagctggtattaaaaatattcaa
attggtatggcacaccgtggtcgtttaaatgtactgactcacgtattagagaaaccatat
gaaatgatgatttcagagttcatgcatactgatcctatgaagttcttgccagaagatggt
agcttagaattaactgctggttggactggtgatgtgaagtatcacttaggtggcgtgaaa
actacagattcatacggtattgaacaacgaatcgctttagcaaacaacccaagtcacttg
gaaattgtagcgcccgttgttgaaggtcgtactcgtgctgctcaagataatacgcaacaa
gcaggcgcaccacaaactgacttccataaagctatgccaatcattattcatggtgatgct
gcttatcctggtcaaggtattaactttgaaacaatgaacttaggtgatttaaaaggctac
tcaacaggtggttctttacacatcatcacaaacaaccgaattggtttcacaactgaacca
acagatggccgttctacaacatactcaacagatgtggctaaaggttatgatgttccaatt
ttacatgttaatgctgacgacgttgaagcaacaattgaagctattgatatcgcaatggaa
ttccgtaaagagttccataaagatgttgtcatcgacttagtaggttatagacgttatggt
cataacgaaatggatgaaccgtcaattacaaatccattaccataccacaatatccgtaag
catgattcagtagaacttgtttatggtaaaaaattagtggacgaaggcattattagtgaa
gatgaaatgaatcaagtcattgatagtgttcaaaaagaaatgcgtgcagcacatgataaa
attgacaaatcagataaaatggacaatccagatatggaaaaaccagaatccttacaacaa
ccacttaagagtgatgataaagagttcacatttgatcacttaaaagaaatcaatgacgcg
atgttaacatatcctgaaggattcaatgtgttgaaaaaattaaataaagtacttgaaaaa
cgtaaagaaccatttgaaaaagaagatggtttagtagattgggcacaagcggaacaactt
gcttttgcaacgattttacaagatggtacttctattcgtttaactggtcaagacagtgaa
cgtggtacattcagtcatcgtcatgcagtactacacgatgaagaaaatggtgatacattc
acaccattacatcatgtacctgatcaaaaagcatcattcgatattcataattcaccatta
tcagaagcagctgttgttggttttgaatatggttacaatgtcgaaaataaaggtagcttc
aacatttgggaagcacaatatggggacttctcaaatatggctcaaatgatgtttgataac
ttcttatcaagtgcgcgagcaaaatggggcgaacgttcaggtttaacattattcttacct
cattcatttgaaggtcaaggtccagaacattcatcagcacgccttgaaagattcttacaa
cttgcagcagaaaacaatagcactgtagttaacttatcaagtgcaagtaactacttccac
ttactacgtgcgcaagcagcaagcttagattctcaagaaatgagacctttaattgttatg
tcaccgaaaagtttattacgtaacaaaacagttgctaaaccaattaatgagtttacgact
ggtggtttcaaaccgatcattgctgaagattatgaagctaataaagttaaaaaagtaata
ttagcttcaggtaaagtatttatcgacttaaaagaatatttagctaaaaatcctgacgaa
tctgtattacttgtagcagttgaaagattatatccattccctgaagaggaaatccaagaa
attttcgatcaactaccaaatcttgaatcagtatcatgggtacaagaagaacctaaaaac
caaggtgcatggttattcgtttatccttacctaagatcattagttggtgataaatacgat
ttaagttaccatggaagaatccaaagggcagcaccagctgaaggtgatggagaaatccat
aaacttgttcaaaataatattattgaaagtagcattactaaataa

DBGET integrated database retrieval system