KEGG   Shewanella woodyi: Swoo_0021Help
Entry
Swoo_0021         CDS       T00676                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
swd  Shewanella woodyi
Pathway
swd00071  Fatty acid degradation
swd00280  Valine, leucine and isoleucine degradation
swd00281  Geraniol degradation
swd00310  Lysine degradation
swd00362  Benzoate degradation
swd00380  Tryptophan metabolism
swd00410  beta-Alanine metabolism
swd00640  Propanoate metabolism
swd00650  Butanoate metabolism
swd00903  Limonene and pinene degradation
swd00930  Caprolactam degradation
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01200  Carbon metabolism
swd01212  Fatty acid metabolism
Module
swd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Swoo_0021
   00650 Butanoate metabolism
    Swoo_0021
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Swoo_0021
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swoo_0021
   00310 Lysine degradation
    Swoo_0021
   00380 Tryptophan metabolism
    Swoo_0021
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Swoo_0021
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Swoo_0021
   00281 Geraniol degradation
    Swoo_0021
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Swoo_0021
   00930 Caprolactam degradation
    Swoo_0021
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Swoo_0021
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Swoo_0021
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Swoo_0021
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Swoo_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACA84322
UniProt: B1KCZ3
LinkDB All DBs
Position
complement(26419..28569)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIARLCFNAAGSVNKLDRETIDSLNAALDAIKQDTNIQGLVLTSG
KGAFIVGADITEFLGLFAQEESVLLPWIAEANVVFNKIEDLPFPTISAINGFALGGGFET
VLATDFRIADTTAKLGLPETKLGLIPGFGGTVRLPRLIGADNALEWITTGKDHKPEAALK
VGAIDAVVAPENLEASAIAMLKEALSEKLDWQARRAKKQAPLNLPKLEAMMSFATAKGMV
FKVAGKHYPAPMTAISVIEQAARSERADALMVEHQAFIKLAKTDVAQALIGIFLNDQLVK
GKAKKAGKLAKNVDSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEASKLL
AAQIKRGRSTPEKMAKVLNNITATLDYAPVKDVDVVVEAVVEHPKVKSMVLAEVEQNVSD
DAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGPAYL
LDVVGIDTGHHAQAVMAEGFPDRMGKDGKDAIDIMFDSERFGQKNNKGFYAYSVDRRGKP
KKDLDPTSYELLGAEFGDLKAFESDEIIARTMIPMIIETVRCLEEGIIATPAEADMGLVF
GLGFPPFRGGVFRYIDTMGVANFVALADKYAHLGGLYQVTDAMRELAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacgattcaggttgagttacttgaagacaatattgctcggtta
tgctttaacgctgccggctctgtcaataaactagacagagagacaatagactcactcaat
gctgcattagacgcaattaagcaagacacgaatattcaaggtctcgttctgacttcagga
aaaggcgcctttattgtcggtgctgacatcactgaatttctcggtctatttgctcaagag
gagagtgttcttcttccttggattgctgaagcaaacgttgttttcaataaaattgaagac
ctgccattccccacgatctcagccattaatggctttgcactgggtggcggttttgaaacc
gtactcgcaacggatttccgtattgctgataccacagccaaacttggcctaccagaaact
aagcttggattaattccaggttttggcggcacagttcgtcttccccgccttattggtgcc
gataacgcacttgagtggatcacaactggtaaagatcataagccagaagccgctcttaaa
gttggtgctatcgacgcagttgtcgcaccagagaatttagaggcatcggctatcgccatg
ctgaaagaagccttaagtgaaaagttagattggcaggcacgccgcgctaaaaagcaagct
ccgctaaacctacctaagcttgaagctatgatgtcattcgccaccgccaagggcatggta
tttaaggttgcaggcaaacactaccctgcgccaatgacagccattagcgttatcgagcaa
gctgctcgcagtgaacgcgctgacgcattaatggtcgagcatcaagcctttatcaagctc
gctaaaaccgacgtagcacaagcgctaatcggtatcttccttaatgaccaactggtcaaa
ggcaaagctaagaaagcgggtaagttagctaaaaatgtcgacagtgctgctgtacttggt
gccggcatcatgggtggtggtatcgcataccagagtgccagcaaaggcacaccaattgtg
atgaaagatatcgcacagccagcgcttgatcttggtctaggtgaagcgtctaagctatta
gccgctcaaattaagcgtggccgctctacaccagagaagatggctaaggtactgaacaac
atcaccgcgacactggactacgcgccggttaaagatgtcgatgttgtagtcgaagccgtt
gttgagcatccaaaagtaaaatccatggtgcttgctgaagttgagcaaaatgtcagtgac
gatgccatcatcacatcaaacacctcaaccatctcaatcaacctactcgctaagagcctt
aagaagcctgagcgcttctgtggaatgcacttctttaacccagtgcataagatgccactt
gttgaagttatccgcggcgaaaacagctctgaagagactatcgcttcggtcgtggcttat
gccagtaaaatgggtaagacaccaatcgttgttaatgattgcccaggtttcttcgtaaac
cgcgtactcttcccttactttgcaggctttagcggtctactcgccgatggcgcagatttc
gcggcaatcgataaggtgatggagaagcagtttggttggcctatgggtcctgcatacctg
cttgatgttgtcggtatcgatacaggccatcatgctcaagcggtaatggcagaaggtttc
cctgatcgcatgggtaaagatggcaaagatgctatcgatatcatgtttgactcagagcgt
ttcggtcagaagaacaacaaaggtttctacgcttactcagtagaccgccgcggcaaacca
aagaaagatctcgatcctacaagctatgagctacttggcgcagagtttggtgatcttaaa
gcatttgagtccgatgagattatcgctcgtactatgatccctatgattatcgaaacagtt
cgttgtctcgaagagggaattatcgcaacgcctgcagaagctgatatggggctagtattt
ggtcttggcttcccaccatttagaggtggtgtattccgctatatcgataccatgggtgtc
gctaatttcgttgcacttgctgataagtacgcccacttaggtggactttaccaagtgaca
gatgcgatgcgcgaactcgccgctaataatggcagctactatcaagcttaa

DBGET integrated database retrieval system