KEGG   Shewanella woodyi: Swoo_0929Help
Entry
Swoo_0929         CDS       T00676                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Swoo_0929
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Swoo_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Phage_TAC_11 Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACA85222
UniProt: B1KFQ6
LinkDB All DBs
Position
1232677..1234245
Genome map
AA seq 522 aa AA seqDB search
MLDTNLKNQLNTYLQNLKRPVELVVSADSSPKAQELKALAQDIESLSPLVSITEAEGKRM
PSMKVTSVETQTDITFAGLPMGHEFTSLVLALLHTGGHPLKLDDEVIEQIKALPGEYHFE
TYVSLSCQNCPDVVQALNMMAAINPNITNVMIDGSLFQTEVFERDILAVPSVYLNGKVFA
QGRISLTEILNKLDTGAVARQAEVIAEKEAFDVLVVGGGPAGASAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDNQRALSLKSGELFELE
LESGAKLRSKTVLLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKSVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDTNLRADEVLQRKAASMGNIKIITQAMTTEVVGDGKRVNG
LNYTDRATGESHHLELAGIFVQIGLMPNSEWLKETISLTERGEIIVDGKGETSLPGVFAA
GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHSAPEQSQAAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacgaatcttaagaatcaactgaatacctacctgcaaaacctcaagcgccca
gttgaacttgtcgtgtctgcagattcaagccctaaagctcaagagcttaaagctttagct
caagatattgaaagtttgtcaccgttagtgagcattactgaagcagaaggtaagcgtatg
ccttcgatgaaagtgacgagtgttgagacacaaactgatatcacttttgcgggcctacct
atgggccacgaatttacttcacttgtactcgcactgttacacactggtggtcatccattg
aagcttgatgatgaggtgatagaacagattaaggcattgccaggtgaatatcattttgaa
acttatgtttctcttagttgccaaaactgccccgacgtggtgcaggccttgaatatgatg
gcggcgatcaatcccaatataaccaatgtcatgatcgatggctcactgtttcaaacagag
gtatttgagcgtgatattttagctgtgccttcggtttacctaaatggcaaggtgtttgct
caaggtagaattagcctcaccgaaattctgaataagctggatactggtgcagtagctcgt
caagcagaagtgatcgcagagaaagaagcgttcgatgtacttgtcgttggtggtggtccc
gctggtgcttcagctgctatttatgccgctcgtaaagggttacgtacaggtattgttgct
gacaagtttggtggccaagtggctgaaaccgttggtatcgagaattttatctctgtaaag
gcgactgaaggtcctaagctggttgcaaatttggaagcccatgttcatgagtatgatgtt
gatatcatggataatcaaagagccttatcacttaagtctggcgagctttttgagttggag
ctggaaagcggcgccaaactaagaagtaaaaccgtgctattagcaacaggcgctagatgg
cgtgagatgaacgtccccggtgagcaagagtatcgcggtaaaggtgtggcttactgtcct
cactgtgatgggccgctatttaaaggtaaatccgtagctgtcattggtggcggtaattca
ggtatcgaagcggcaattgacttagccaacatcgttgagcatgtcaccgtattggagttt
gataccaatttaagagccgatgaggtgctgcaacgtaaagctgcttctatggggaatatc
aagatcattacccaagcgatgaccacagaagtggttggtgatggtaagcgagtaaacgga
cttaattataccgatagagcgacaggagaaagtcatcaccttgagctagctggcatattt
gtccagataggtttgatgcctaactcagagtggctaaaagagactatatcgttaactgaa
cgtggcgagataattgtcgatggcaaaggtgaaacatctctaccgggtgtatttgcagca
ggtgatgtcactaactctgcctataagcagatcattatagccatgggcagtggcgcaact
gcatcactgggggcttttgattacctcattaggcatagcgcaccggagcagtcacaagct
gcagcttaa

DBGET integrated database retrieval system