KEGG   Shewanella woodyi: Swoo_2159Help
Entry
Swoo_2159         CDS       T00676                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
swd  Shewanella woodyi
Brite
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Swoo_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACA86443
UniProt: B1KDP6
LinkDB All DBs
Position
complement(2652725..2653306)
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYAKDALEPHISQETIEYHYGKHHNTYVVKLNGLVEGTELAEKSLEEIIKTS
SGGIFNNAAQIWNHTFYWNCLSPNGGGAATGAVAKAIDDAFGSFEAFKAQFTDAAVNNFG
SAWTWLVKNADGSVAIVNTSNAATPLTDSSVTPIMTVDVWEHAYYIDYRNVRPDYLAHYW
ELVNWDFVNQNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccagcactaccttacgctaaagatgctcttgaaccccatatttct
caagaaaccatcgaataccattatggtaagcatcataacacttatgttgtaaagcttaat
ggtctagtagaaggtacagagttagctgaaaagagcctagaagagatcattaaaacctct
tctggtggaatttttaataatgcagcccaaatatggaatcacactttttactggaactgt
ctatcaccaaatggcggtggtgcagcaacaggcgcagtagccaaagcaattgatgatgca
tttggatcttttgaagcctttaaagcgcaatttactgatgccgcagtgaacaactttgga
agtgcttggacttggcttgtaaaaaatgccgatggttcggttgcaatcgtcaacacaagc
aatgctgccactccactaactgatagcagtgttacacctatcatgactgtggatgtgtgg
gagcatgcttactatatcgattaccgcaatgtgagacctgattaccttgctcactactgg
gagttggtaaactgggatttcgtgaatcaaaatttcgcttaa

DBGET integrated database retrieval system