KEGG   Shewanella woodyi: Swoo_2544Help
Entry
Swoo_2544         CDS       T00676                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
swd  Shewanella woodyi
Brite
KEGG Orthology (KO) [BR:swd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:swd01002]
    Swoo_2544
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:swd04147]
    Swoo_2544
   04090 CD molecules [BR:swd04090]
    Swoo_2544
Enzymes [BR:swd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Swoo_2544
Peptidases [BR:swd01002]
 Metallo Peptidases
  Family M2
   Swoo_2544
Exosome [BR:swd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Swoo_2544
CD molecules [BR:swd04090]
 Proteins
  Swoo_2544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ACA86821
UniProt: B1KGV2
LinkDB All DBs
Position
3111666..3113504
Genome map
AA seq 612 aa AA seqDB search
MKLSTARLSKISLLVGLTLAATACQKVQSDETVSAQTSVAEAEQFITQSEQALSELSIEV
NRSEWIYSNFITEDTAALSASVGEKYTATTVKLATVAANYTQLPLSADNLRKLNILRSAL
VLPAPLDPKKNAELASISSELNGLYGKGKYCFDDGRCLTQPELSAIMGESQDPALLLEVW
KGWRDIAKPMRPLFKREVELANEGARDLGYADLSELWRSQYDMEPDEFSNELDRLWGQVK
PLYDSLHCYVRGELNEKYGDDVVSKQGPIPAHLLGNMWAQSWGNIYNQVAPEDADPGYDV
TELLAQHGYDEIKMVKQAESFFSSLGFEPLPDTFWERSLFVQPKDRDVVCHASAWALDDK
DDIRIKMCIQKTAEDFTVIHHELGHNYYQRAYKNQPFIFKNSANDGFHEAIGDTVALSIT
PNYLKQIGLLDEVPDASKDIGLLLKQALDKVAFMPFGLMIDQWRWKVFSGEITPEQYNQA
WWELREKYQGVKSPISRDEKDFDPGAKYHVPGNVPYTRYFLAHILQFQFHKALCDIAGDK
GPVHRCSIYGNKDAGTKLNTMLEMGQSQPWPEALAVVTGSKEMDANAVLDYFAPLQTWLN
EQNSQANRQCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttccactgcaagactttcaaagatctcgctgctggtcggcttaacattagcc
gccacagcttgtcaaaaagtgcagtctgacgaaacagtatcagcacaaaccagcgttgca
gaagccgagcaatttataacacaatccgaacaagccttgagcgaactctctatcgaagtt
aatcgttcagagtggatctacagcaactttattacggaagataccgctgccttatcagct
tcagttggagagaaatacaccgcgacgactgtgaagcttgccacagttgctgcaaactac
actcaacttcctctcagtgccgataatttacgtaagctcaacattctacgcagcgcacta
gtcctgccagcacctttagatccaaagaaaaatgctgaacttgccagcatcagttcagaa
ctcaatggactctatggtaaaggaaagtactgttttgacgatggtcgctgcctaacacaa
cctgaactgtcagccattatgggagaatcccaagaccctgcacttttattagaggtgtgg
aaaggatggcgtgatatagccaaacctatgcgtcctctgtttaagagagaagttgaactt
gccaatgaaggagcacgggatctaggctatgccgatctttcagagctatggcgtagccaa
tacgatatggagcctgatgagttctctaatgaactggacagactctggggacaagtgaaa
ccactgtacgattcacttcactgttatgtcagaggtgagctaaatgagaagtacggtgat
gatgtagtatcaaaacagggacctattcctgctcatctactgggcaatatgtgggcccaa
agttggggcaatatctacaaccaagttgcaccagaagatgcagatcccggttatgatgtc
accgagctgcttgcacagcatggttatgatgagatcaagatggtgaaacaagctgaaagc
tttttcagctcactgggttttgagccacttccagataccttctgggaacgctctttattt
gtccaacctaaagacagagatgttgtgtgtcatgcatcagcctgggctctggacgacaaa
gatgatatccgcatcaagatgtgtatccagaaaacggcagaggacttcactgttattcat
catgagctagggcataactattatcaaagagcctataagaaccagccatttattttcaaa
aacagcgcaaatgatggtttccatgaagccataggtgacactgttgccctctctatcaca
cccaattacttaaaacagattggtctgttggatgaggtgcctgatgcctctaaagacatt
ggtctgttactcaaacaagcactcgacaaggtcgccttcatgccatttggcttaatgata
gatcaatggcgatggaaagtgtttagtggtgaaataactccagagcaatacaaccaggct
tggtgggagttaagggagaagtatcaaggggtgaagtcaccaatcagtcgtgatgaaaaa
gattttgatcctggagctaaataccatgtaccaggaaatgtcccctatacacgctacttc
ttagctcatatcttacagttccagttccacaaagctttgtgtgacatcgctggcgataag
ggccctgtacaccgttgtagtatctacggcaataaagacgcgggcactaagctaaatacc
atgcttgagatgggacaaagtcaaccttggccagaagccttagccgttgtgacaggcagt
aaagagatggacgccaatgcagtacttgattactttgcaccattacaaacttggttaaat
gagcaaaatagccaagccaatagacaatgtggttggtaa

DBGET integrated database retrieval system