KEGG   Shewanella woodyi: Swoo_3792Help
Entry
Swoo_3792         CDS       T00676                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
swd  Shewanella woodyi
Pathway
swd00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Swoo_3792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:swd01003]
    Swoo_3792
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:swd01011]
    Swoo_3792
Enzymes [BR:swd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Swoo_3792
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Swoo_3792
Glycosyltransferases [BR:swd01003]
 Polysaccharide
  Bacterial polysaccharide
   Swoo_3792
Peptidoglycan biosynthesis and degradation proteins [BR:swd01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Swoo_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ACA88051
UniProt: B1KEN6
LinkDB All DBs
Position
complement(4628139..4630511)
Genome map
AA seq 790 aa AA seqDB search
MTDKETSKKPARKKAAPKSGAKKPAAKKRAAKAKSASKGSPSIGRRIWSISWKLGLILFV
GVLSYGIYLDQVIARKFEGQKWHLPAQVFSRSMALYPGAAVSHGQLIAELKLLGYRKVAN
PRQVGEFSASKTRVDLWRRPFLHPQGAQAEQRVMITFDQQGVSSVARNTDNRQLAVFHLE
PVLLDRIITGDGEDRLFVPTTKMPQSIIDSLILVEDRSFYEHHGVNPFAIIRAALVNISA
GRTVQGGSTLTQQLAKNFFLSSERSLVRKIREALMAIIIDFRYEKDEILEAYLNEVYMGQ
DKARGVHGMGLASQFYFGRPIAELTLPQQAFLVAVIKGPSYYNPWRYPERAASRRDLVLR
LLMEDGKLNVQQYTAAVESPLGLRSADKPVHQKLPAFFAVVQHELNRRFGDSLLKQSGIK
VYTTLDPMAQEAAEKAVKKTMARLGKNDKILQVGMVVTDKYSAGIAAMVGDKVPSYKGYN
RAVEIRRPIGSLVKPFVYATALNQPAKYTLATPLKDQPITLNNGHGKTWSPKNVDKKFRG
EVPLLTAFKRSINVPTVNLGMEMGVSSVATTLDKSGWRDKISEYPSMLLGAVNGSPLMVA
QVYQTIADNGRYRRLSSVTAVLDMENNPLPVARVEQDQALNPSSTYLVQYAMTQVVKSGT
ASRLGKAFPYVTLAGKTGTSNDSRDSWFAGFDERNVAAIWVGRDDNGKTGLYGSSGAMAV
YQDFLGTRPPISLRRPLISGVVNGHFDKTTGVAKEAGCENSIALPALEASYHPARNCGEP
LSWWQKLTGG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaagagacttcaaagaaacctgcgcgtaaaaaagcggctcctaaatctgga
gcgaaaaagccagcagccaaaaagcgtgcagccaaagcaaagagtgccagtaaaggctca
ccaagtataggcagacggatctggtctatcagctggaagctaggcctgatcttatttgta
ggcgtgttgagctacggcatctacctagatcaagtaatagctcgaaaatttgaggggcag
aaatggcacctacctgctcaagtgtttagccgctcaatggccctttatcctggcgcagct
gtgagtcacggtcagttaattgctgaattaaaattgctgggttatcgcaaagtggctaac
ccaaggcaagtgggtgagttctctgcatctaaaactcgggtagatttgtggcgtcgtccc
ttcctgcatcctcaaggagcccaagctgagcagagggttatgatcacttttgatcaacaa
ggggtaagttcggtagcaaggaacacagataatcgtcagttagcggtttttcatctcgaa
cctgtgctgcttgaccgtattattactggcgatggagaagatcgtctgtttgtcccgacc
actaagatgcctcagtctattatcgactcactgatcttggtggaagatcgcagcttctat
gaacatcatggcgtaaatccgtttgccattattcgtgccgcactggtgaatatcagtgcg
gggcgcacagtgcaggggggctcaacgttaacgcaacagctggcgaaaaacttcttcctc
tccagtgagcgctcgttagtgcggaaaattcgggaagccttgatggcgataatcatcgat
tttcgctatgaaaaggacgaaatattagaggcttatcttaatgaagtgtacatgggacaa
gataaagcccgtggagtacatggtatgggactggcctctcagttctatttcggtcgtccc
attgctgagttaactttgccgcagcaagcattcttggtcgctgtgataaagggcccctct
tactacaacccttggcgctatcctgagcgggctgcaagccgccgcgatctagtgctacgc
ctcttgatggaggacggtaagcttaatgtgcagcagtatactgctgccgttgagtcgcct
ttaggtcttcgaagtgccgacaaacctgtccatcaaaagctgcctgcatttttcgccgtg
gttcagcatgagcttaacagacgctttggcgactctttgttaaaacagtcgggtattaag
gtctatacaacgctggatcctatggcgcaggaagcggctgaaaaagcggtgaaaaagacc
atggcccgtctaggaaaaaatgacaagatattgcaagtgggtatggtggttaccgataaa
tattcggcaggtatagcagccatggtgggggataaagtgccgagttataaaggctataac
cgcgctgtagagatcaggcgtccaatcggctcactagtcaaaccttttgtctatgcgacc
gcgttgaatcaacctgctaaatatactttagcgacgccacttaaggatcaacctattacc
ctgaacaacggccatggtaagacctggtcacctaagaatgtggataagaagtttagaggt
gaagtaccactattgaccgcctttaagaggtcaattaacgtacctacggtcaatttaggt
atggagatgggggtcagcagtgtggcgaccacgctcgataaatctggctggagagataaa
ataagtgaatatccctctatgctgttaggtgctgttaatggctcaccgctgatggtcgct
caggtctatcaaaccatagcggacaacgggcgttatcgccgtttatcatcggtgacggct
gtgctggatatggagaataaccctctgcctgtggcgcgtgttgagcaggatcaagcattg
aatccaagctccacctatctggtgcaatatgccatgacccaagtggttaaatccggtacg
gcaagcaggcttggaaaggccttcccctatgtgaccttggcaggtaaaactgggaccagt
aatgactcccgcgactcctggtttgctggatttgatgagcgtaatgtcgctgccatctgg
gttggacgtgatgacaacggtaaaacaggtctttatggcagtagtggcgccatggctgtc
tatcaagactttctcggtactcgaccaccaatcagtctaagacgccctttaatcagtggg
gtggtcaatggccactttgacaaaacaaccggtgttgctaaagaggcgggctgtgaaaac
tctatcgcactgcctgcattggaagccagttatcatcccgctagaaactgcggtgaacct
ttgtcttggtggcagaagttgactggaggttaa

DBGET integrated database retrieval system