KEGG   Shewanella woodyi: Swoo_4423Help
Entry
Swoo_4423         CDS       T00676                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
swd  Shewanella woodyi
Pathway
swd00620  Pyruvate metabolism
swd01100  Metabolic pathways
swd01120  Microbial metabolism in diverse environments
swd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swoo_4423
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Swoo_4423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic Malate_DH
Motif
Other DBs
NCBI-ProteinID: ACA88675
UniProt: B1KK44
LinkDB All DBs
Position
complement(5357911..5359158)
Genome map
AA seq 415 aa AA seqDB search
MSDFRQQALDYHEFPVPGKTAVCLTKSAETSMDLALAYSPGVAEPVREIAANPDNAYRYT
AKGNTVAVISNGTAILGLGNLGPLASKPVMEGKALLFKRFANIDSTDIEVKHRTPEEFIN
TVEAIADTFGGINLEDIKAPECFEIEKALIERCNVPVFHDDQHGTAIVTAAGMINALEIQ
GKKIEESIFVCMGAGAAAIACMTMLVKCGVQRENVYMLDRKGVIHTRRDDINEYKALFAN
NTDKRTLQDVIKGADAFLGLSGPDVLSAEDIALMAENPVVFACSNPDPEIKPEVAHEARK
DLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASQINDEMKIAAVHAIAELAKEEVPASV
LAAYPDVSELKFGPQYVIPKPMDPRLLQNVAKAVAQAAIDSGVAAIQSLPENYLG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttcgtcaacaagccctcgattaccatgagtttccagtgccaggaaaaaca
gccgtttgcctgactaaatcagctgaaaccagtatggatttagcattagcctatagcccg
ggtgttgctgaacctgtacgtgaaattgctgcgaacccagataatgcctatcgctacaca
gctaagggaaataccgttgcggttatctctaacggtactgcaattttaggtctgggaaat
ctggggcctttggcatctaaacctgttatggaaggtaaagcactgctatttaaacgcttc
gctaatattgactccactgatattgaagtcaaacaccgtacacctgaagagtttatcaat
accgtagaagcgattgccgatacatttggtggtattaatttagaagatatcaaagcgcca
gagtgttttgagattgagaaggcattgattgagcgctgtaatgttcctgtatttcatgat
gatcaacatggtaccgccattgttactgctgcgggcatgatcaacgcacttgagatccaa
ggtaagaagattgaggagtcaattttcgtttgtatgggagcaggtgctgctgcaatcgca
tgcatgacaatgctggttaagtgtggtgtacagcgtgaaaatgtttacatgttagataga
aaaggtgtgatccatacacgccgcgatgatatcaacgagtacaaggccttatttgctaat
aacaccgataagcgtaccttgcaggatgtgattaaaggggctgatgcattcttaggtcta
tctggacctgatgtgttgagcgctgaagatattgcactgatggcggaaaatccagttgtc
ttcgcttgctcaaatcctgatcctgaaatcaagcctgaagtggcccatgaggctcgtaaa
gacttgattatggggactgggcgtagcgattaccctaaccaagtgaataatgtactctgc
ttcccgtttattttccgtggcgcactcgatgttcgcgcttctcaaattaatgatgagatg
aagattgccgcagtacatgccatagcagaattggctaaagaagaggttcctgcttctgtt
ttggctgcctacccagatgtgtctgaattgaagtttggaccacagtatgtgatccctaag
cctatggatccaagattacttcaaaatgtcgctaaggcggtggcacaggctgctattgat
tcaggcgttgctgctatacagagcttaccagagaactacctgggctaa

DBGET integrated database retrieval system